product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
PIGF1 protein (His Tag)
catalog :
MBS536567
quantity :
0.02 mg
price :
780 USD
more info or order :
product information
catalog number :
MBS536567
products type :
Recombinant Protein
products full name :
PIGF1 protein (His Tag)
products short name :
[PIGF1]
products name syn :
[PGF protein; Placenta Growth Factor-1 protein; PIGF-1 protein; PIGF 1; PIGF-1; PIGF protein; PIGF 1 protein; PIGF1]
products gene name :
[PIGF1]
host :
Human
sequence :
LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALER
LVDWSEYPSEVEHMFSPSCVSLLRRCTGCCGDENLHCVP
VERANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPI
LVDWSEYPSEVEHMFSPSCVSLLRRCTGCCGDENLHCVP
VERANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPI
purity :
> 95% pure
form :
Lyophilized powder with carier protein (HSA). Reconstitute with 0.1 M Acetic Acid or DI water. Can be diluted further with PBS or buffer of choice.
storage stability :
Stable at room temperature. Best stored at -20°C to -70°C.
tested application :
User optimized
other info1 :
Source: Insect cells. Contaminants: Endotoxin level: 6 units/mg. Protein Type: Binding Protein. Biohazard: For research use only. Use standard laboratory precautions when handling.
other info2 :
Tag/Conjugate: His Tag. Biological Significance: Human Placenta Growth Factor-1 (PlGF-1), a 19 kDa protein consisting of 131 amino acid residues and fused to a C-terminal His-tag (6x His), is produced as a homodimer. Human Placenta Growth Factor (PlGF) is a polypeptide growth factor and a member of the platelet-derived growth factor family but more related to vascular endothelial growth factor (VEGF). PlGF-1 acts only as a very weak mitogen for some endothelial cell types and as a potent chemoattractant for monocytes. The physiological function in vivo is still controversal. In several reports it was shown not to be a potent mitogen for endotehlial cells and not angiogenic in vivo by using different assays.
products categories :
Cytokines & Growth Factors; Binding Protein; Conjugated Proteins
products description :
Purified recombinant Human PIGF1 protein (His Tag)
ncbi mol weight :
19 kDa
size1 :
0.02 mg
price1 :
780 USD
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!