product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Rotavirus VP4 protein (His tag)
catalog :
MBS5304598
quantity :
0.25 mg
price :
595 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS5304598
products type :
Recombinant Protein
products full name :
Rotavirus VP4 protein (His tag)
products short name :
[Rotavirus VP4]
products name syn :
[Glycoprotein VP4 protein; Rotavirus protein; VP4 protein; Outer capsid glycoprotein VP4]
host :
E. coli
sequence :
KAANYQYNYLRDGEQVTAHTTCSVNGVNNFSYNGGLLPTHFSISRYE VIKENSYVYVDYWDDSQAFRNMVYVRSLAANLNSVKCSGGNYNFQ MPVGAWPVMSGGAVSLHFAGVTLSTQFTDFVSLNSLRFRFSLTVEEP PFSILRTRVSGLYGLPASNPNSGHEYYEIAGRFSLISLVPSNDDY
AQVSEDIIISKTSLWKEMQYNRDIIIRFKFNNSIIKLGG
LGYKWSEISF
purity :
> 90% pure
form :
Liquid in PBS,pH 7.4 with 20% glycerol.
concentration :
1.2 mg/mL
storage stability :
Store at 4°C for short term to -80°C for long term. Avoid repeat freeze/thaw cycles.
other info1 :
Protein Type: Recombinant. Species: Strain RVA/Human. Residues: 247-479 aa
other info2 :
Tag/Conjugate: His tag
products categories :
Infectious Disease
products description :
Purified recombinant Rotavirus VP4 protein (His tag). VP4 an outer capsid proteins, induces neutralizing antibodies and is responsible for Rotavirus serotype specificity.
ncbi mol weight :
42.29 kDa
size1 :
0.25 mg
price1 :
595 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!