product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Rotavirus VP7 protein (His tag)
catalog :
MBS5304278
quantity :
0.25 mg
price :
625 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS5304278
products type :
Recombinant Protein
products full name :
Rotavirus VP7 protein (His tag)
products short name :
[Rotavirus VP7]
products name syn :
[Glycoprotein VP7 protein; Rotavirus protein; VP7 protein; Outer capsid glycoprotein VP7]
host :
Human
sequence :
QLFLTKGWPTGSVYFNEYSNVLEFSIDPKLYCDYNVVLIRFVSGEELDISELADL ILNEWLCNPMDITLYYYQQTGEANKWISMGSSCTVKVCPLNTQTLGIGCQT TNTATFETVADSEKLAIIDVVDSVNHKLNITSTTCTIRNCNKLGPRENVAIIQVG GSNILDITADPTTSPQTERMMRVNWKKWWQVFYTVVDYINQIVQVMSKR SRSLDSSSFYYRV
QNYGINLPITGSMDTAYANSTQDNNFLFSTLCLYYPSEA
PTQISDTEWKDTLS
purity :
> 90% pure
form :
Liquid in PBS, pH7.4 with 20% glycerol.
concentration :
1.6 mg/ml
storage stability :
4 degree C shipping only. Upon receipt store at -20 degree C to -80 degree C. Avoid repeat freeze-thaw cycles.
other info1 :
Protein Type: Recombinant. Biological Significance: VP7 is a major capsid glycoprotein found in rotavirus. Rotavirus attachment and entry into the host cell probably involves multiple sequential contacts between the outer capsid proteins VP4 and VP7, and the cell receptors. In integrin-dependent strains, VP7 seems to essentially target the integrin heterodimers ITGAX/ITGB2 and ITGA5/ITGB3 at a postbinding stage, once the initial attachment by VP4 has been achieved
other info2 :
Expression System: E Coli. Tag/Conjugate: His tag. Species: Human
products categories :
Infectious Disease
products description :
Purified recombinant Rotavirus VP7 protein (His tag)
ncbi mol weight :
34 kDa
size1 :
0.25 mg
price1 :
625 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!