protein

RuBisCO protein

MBS5303596

10 mg

875 USD

Native Protein

RuBisCO protein

[RuBisCO]

[Ribulose-1 5-bisphosphate carboxylase oxygenase protein]

Purified from spinach leaf.

NNWPCNPEKTLISHVPKERLIMSFGSGYGGNSLLGKKCF
ALRIAGCIARDEGWLAEHMLIMSVTNPKGEE

> 95% by SDS-PAGE

Liquid in PBS, pH 7.4 with 10% glycerol.

1.99 mg/mL

Shipping: Blue Ice. Upon receipt store at -20°C or -80°C . Avoid repeated freeze-thaw cycles.

Western Blotting (WB), ELISA (EIA)

SDS-PAGE

Grade: Native protein. Species: Spinach

Biohazard: Use standard laboratory procedures when handling this product.

Proteases, Inhibitors, Native Protein

Ribulose-1,5-bisphosphate carboxylase oxygenase, most commonly known by the shorter name RuBisCO, is an enzyme involved in the Calvin cycle that catalyzes the first major step of carbon fixation, a process by which the atoms of atmospheric carbon dioxide are made available to organisms in the form of energy-rich molecules such as glucose. RuBisCO catalyzes either the carboxylation or the oxygenation of ribulose-1,5-bisphosphate (also known as RuBP) with carbon dioxide or oxygen. RuBisCO is very important in terms of biological impact because it catalyzes the primary chemical reaction by which inorganic carbon permanently enters the biosphere.

10 mg

875 USD