product summary
Loading...
company name :
MyBioSource
product type :
antibody
product name :
HS3ST6 antibody
catalog :
MBS5301806
quantity :
0.05 mg
price :
430 USD
clonality :
polyclonal
host :
rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, cow, zebrafish
application :
western blot
more info or order :
image
image 1 :
HS3ST6 antibody (MBS5301806) used at 1 ug/ml to detect target protein.
product information
catalog number :
MBS5301806
products type :
Antibody
products full name :
HS3ST6 antibody
products short name :
[HS3ST6]
products name syn :
[Polyclonal HS3ST6; Anti-HS3ST6; Heparan Sulfate; HS3ST5; Glucosamine 3-O-Sulfotransferase 6]
other names :
[Hs3st6 protein; Heparan sulfate glucosamine 3-O-sulfotransferase 6; heparan sulfate glucosamine 3-O-sulfotransferase 6; heparan sulfate (glucosamine) 3-O-sulfotransferase 6; Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 6; 3-OST-6; Heparan sulfate 3-O-sulfotransferase 6]
products gene name :
[HS3ST6]
other gene names :
[Hs3st6; Hs3st6; 3-OST-6; Heparan sulfate 3-O-sulfotransferase 6]
uniprot entry name :
HS3S6_MOUSE
clonality :
Polyclonal
host :
Rabbit
reactivity :
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish.
sequence length :
332
purity :
Affinity purified
form :
Lyophilized powder. Reconstitute with 50 ul distilled water for a final concentration of 1mg/ml in PBS buffer with 2% sucrose.
concentration :
50ug, lyophilized
storage stability :
Ships ambient or refrigerated. Upon receipt store at 4 degree C short term, -20 degree C long term. Avoid repeat freeze-thaw cycles.
tested application :
Western Blot (WB)
app notes :
WB: 1 ug/ml
image1 heading :
Western Blot (WB)
other info1 :
Biological Significance: HS3ST6 is a single-pass type II membrane protein. It belongs to the sulfotransferase 1 family. It transfers a sulfuryl group to heparan sulfate. The substrate-specific O-sulfation generates an enzyme-modified heparan sulfate which acts as a binding receptor to Herpes Simplex Virus-1 (HSV-1) and permits its entry. Unlike 3-OST-1, does not convert non-anticoagulant heparan sulfate to anticoagulant heparan sulfate.
other info2 :
GERLVSDPAGEVGRVQDFLGLKRVVTDKHFYFNATKGFP
CLKKAQGGSRP
Immunogen: Synthetic peptide directed towards the C terminal region of human HS3ST6. Immunogen Information: HS3ST6 antibody was raised using a synthetic peptide corresponding to a region with amino acids
CLKKAQGGSRP
Immunogen: Synthetic peptide directed towards the C terminal region of human HS3ST6. Immunogen Information: HS3ST6 antibody was raised using a synthetic peptide corresponding to a region with amino acids
products categories :
Cell Biology; Purified Polyclonal Antibodies
products description :
Rabbit polyclonal HS3ST6 antibody
ncbi gi num :
219519881
ncbi acc num :
AAI45425.1
ncbi mol weight :
35 kDa (MW of target protein)
ncbi pathways :
Metapathway Biotransformation (198377); Heparan Sulfate Biosynthesis Pathway (542920); Heparan Sulfate Biosynthesis (late Stages) Pathway (542915)
uniprot summary :
HS3ST6: Sulfotransferase that utilizes 3 -phospho-5 -adenylyl sulfate (PAPS) to catalyze the transfer of a sulfo group to heparan sulfate. The substrate-specific O-sulfation generates an enzyme-modified heparan sulfate which acts as a binding receptor to Herpes Simplex Virus-1 (HSV-1) and permits its entry. Unlike 3- OST-1, does not convert non-anticoagulant heparan sulfate to anticoagulant heparan sulfate. Belongs to the sulfotransferase 1 family. Protein type: EC 2.8.2.23; Transferase; Membrane protein, integral. Cellular Component: Golgi apparatus; membrane; integral to membrane. Molecular Function: phenanthrol sulfotransferase activity; trans-3,4-dihydrodiolphenanthrene sulfotransferase activity; proteoglycan sulfotransferase activity; 2-phenanthrol sulfotransferase activity; galactose 3-O-sulfotransferase activity; transferase activity; 1-phenanthrol sulfotransferase activity; sulfotransferase activity; 3-phenanthrol sulfotransferase activity; HNK-1 sulfotransferase activity; N-acetylglucosamine 6-O-sulfotransferase activity; 4-phenanthrol sulfotransferase activity; trans-9R,10R-dihydrodiolphenanthrene sulfotransferase activity; heparan sulfate 2-O-sulfotransferase activity; cholesterol sulfotransferase activity; N-acetylgalactosamine 4-O-sulfotransferase activity; heparin-glucosamine 3-O-sulfotransferase activity; 9-phenanthrol sulfotransferase activity; heparan sulfate 6-O-sulfotransferase activity
size1 :
0.05 mg
price1 :
430 USD
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
browse more products
questions and comments