protein

HCV E2 protein (aa 383-663), Subtype 1a

MBS434232

0.05 mg

370 USD

Recombinant Protein

HCV E2 protein (aa 383-663), Subtype 1a

[HCV E2 protein]

[HCV E2 protein; subtype 1a; HCV E2 PROTEIN; HCV E2 protein]

293 cell culture

AETHVTGGSAGRTTAGLVGLLTPGAKQNIQLINTNGSWH
INSTALNCNESLNTGWLAGLFYQHKFNSSGCPERLASCR
RLTDFAQGWGPISYANGSGLDERPYCWHYPPRPCGIVPA
KSVCGPVYCFPSPVVVGTTDRSGAPTYSWGANDTDVFVL
NNTRPPLGNWFGCTWMNSTGFTKVCGAPPCVIGGVGNNT
LLCPTDCFRKHPEATYSRCGSGPWITPRCMVDYPYRLWH
YPCTINYTIFKVRMYVGGVERLEAACNWTRGERCDLEDR
DRSELS

>= 95% purity

1 ug/ul in PBS with 20% glycerol and 0.1% sodium azide.

Store at -20 degree C. Stable for 3-months from the date of shipment when kept at 4 degree C. Non-hazardous. No MSDS required.

Western Blot (WB), Antigen, ELISA (EIA)

SDS-PAGE

Note: Viral protein purified from 293 cell culture (heavily N-glycosylated)

Endotoxin Level: <0.01 EU per 1 ug of the protein by LAL test. Viral Protein: C-terminal 6xHis tagged HCV E2 protein (amino acid 383-663) (Genebank No. AF009606), subtype 1a

Viral Recombinant Proteins; Hepatitis Virus

Description: 6xHis tagged HCV E2 protein (aa 383-663)(subtype 1a) expressed in 293 cells (Genebank Accession No. AF009606). Viral protein purified from 293 cell culture (heavily N-glycosylated). Introduction: The hepatitis C virus (HCV) is a small, enveloped, single-stranded, positive-sense RNA virus. HCV has a high rate of replication with approximately one trillion particles produced each day in an infected individual. Due to lack of proofreading by the HCV RNA polymerase, the HCV has an exceptionally high mutation rate, a factor that may help it elude the host's immune response. There are seven major genotypes of HCV with several subtypes within each genotype. The viral RNA codes for a large polyprotein of approx. 3100 amino acids, which is posttranslationally processed by cellular and viral proteases. The N-terminus encompasses the structural proteins core and two glycoproteins (E1, E2); the C-terminus encompasses the p7 protein and the nonstructural (NS) proteins NS2, NS3, NS4A, NS4B, NS5A and NS5B.

0.05 mg

370 USD