protein

HA (H7N9)(aa 19-535) (A/Wuxi/2/2013)

MBS434212

0.05 mg

355 USD

Recombinant Protein

HA (H7N9)(aa 19-535) (A/Wuxi/2/2013)

[HA (H7N9) (A/Wuxi/2/2013)]

[HA (A/Wuxi/2/2013)(aa 19-535); HA (H7N9)(aa 19-535) (A/Wuxi/2/2013); ha (h7n9) (aa19-524) (a/wuxi/22013)]

[hemagglutinin; Hemagglutinin]

[HA]

[HA]

S4UZS9_9INFA

293 cell culture

560

GSDVCYPGKFVNEEALRQILRESGGIDKEAMGFTYSGIRTNGSTSACRRSGSSFYAEMKWLLSNTDNAAFPQMTKSYKNTRK SPALIVWGIHHSVSTAEQTKLYGSGSKLVTVGSSNYQQSFVPSPGARPQVNGLSGRIDFHWLMLNPNDTVTFSFNGAFIAPD RASFLRGKSMGIQSGVQVDANCEGDCYHSGGTIISNLPFQNIDSRAVGKCPRYVKQRSLLLATGMKNVPEIPKGRGLFGAIA GFIENGWEGLIDGWYGFRHQNAQGEGTAADYKSTQSAIDQITGKLNRLIEKTNQQFELIDNEFNEVEKQIGNVINWTRDSIT EVWSYNAELLVAMENQHTIDLADSEMDKLYERVKRQLRENAEEDGTGCFEIFHKCDDDCMASIRNNTYDHSKYREEAMQNRI QIDPVKLSSGYKDV
DKICLGHHAVSNGTKVNTLTERGVEVVNATETVERTNIP
RICSKGKRTVDLGQCGLLGTITGPPQCDQFLEFSADLII
ERRE

> = 95% (SDS-PAGE)

1 ug/ul in PBS

Store at -20 degree C. Stable for 3-months from the date of shipment when kept at 4 degree C. Non-hazardous. No MSDS required.

Western Blot (WB), Hemagglutinin Inhibition Test (HI), ELISA (EIA)

SDS-PAGE

Endotoxin Level: <0.01 EU per 1 ug of the protein by LAL test. Viral Protein: C-terminal 6xHis tagged hemagglutinin (H7N9)(A/Wuxi/2/2013) protein (amino acid 19-535)(Genebank accession# AGN69462.1)

Viral Recombinant Proteins; Influenza

Description: C-terminal 6xHis tagged hemagglutinin HA (H7N9) (A/Wuxi/2/2013) protein (amino acid 19-535)(Genebank accession# AGN69462.1). Viral recombinant protein purified from 293 cell culture. Introduction: Influenza hemagglutinin (HA) is a type of hemagglutinin found on the surface of the influenza viruses. HA is an antigenic glycoprotein, like all other hemagglutinins, it causes red blood cells to agglutinate. HA is responsible for binding the virus to the cell that is being infected. HA proteins bind to cells with sialic acid on the membranes, such as cells in the upper respiratory tract or erythrocytes. HA is a homotrimeric integral membrane glycoprotein. HA monomer is synthesized as a single polypeptide that is subsequently cleaved into two smaller polypeptides, the HA1 and HA2 subunits. Each HA monomer consists of a long, helical chain anchored in the membrane by HA2 and topped by a large HA1 globule. H7N9 is a serotype of the species Influenza virus A (avian influenza virus or bird flu virus). Avian influenza A H7 viruses normally circulate amongst avian populations, but recently new H7N9 variants was first reported to have infected humans in 2013 in China. It is believed that certain mutations might have caused person to person H7N9 transmission.

511105778

AGN69462.1

62,097 Da

Binds to sialic acid-containing receptors on the cell surface, bringing about the attachment of the virus particle to the cell. This attachment induces virion internalization of about two third of the virus particles through clathrin-dependent endocytosis and about one third through a clathrin- and caveolin-independent pathway. Plays a major role in the determination of host range restriction and virulence. Class I viral fusion protein. Responsible for penetration of the virus into the cell cytoplasm by mediating the fusion of the membrane of the endocytosed virus particle with the endosomal membrane. Low pH in endosomes induces an irreversible conformational change in HA2, releasing the fusion hydrophobic peptide. Several trimers are required to form a competent fusion pore.

0.05 mg

355 USD