product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
HBsAg preS1, Hepatitis B Surface Antigen (119 aa)
catalog :
MBS434136
quantity :
0.05 mg
price :
315 USD
more info or order :
product information
catalog number :
MBS434136
products type :
Recombinant Protein
products full name :
HBsAg preS1, Hepatitis B Surface Antigen (119 aa)
products short name :
HBsAg preS1
products name syn :
HBsAg preS1 recombinant protein; HBsAg preS1 Recombinant Protein; HBsAg preS1 Recombinant Protein
products gene name :
HBsAg
host :
E Coli
purity :
> 95% (by SDS-PAGE). Purified by proprietary chromatographic technique
concentration :
1 mug/mul in 20 mM PB, 50 mM NaCl (pH7.4).
storage stability :
Store at 4 degree C but should be kept at -20 degree C for long term storage. Non-hazardous.
tested application :
Western Blot (WB), ELISA (EIA)
app notes :
Immunochromatography, antibody ELISA, antigen, etc.
products categories :
Viral Recombinant Proteins; Hepatitis Virus
products description :
(Genebank accession#, AAK51534).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSN
NPDWDFNPNKDHWPEAHQVGAGAFGPGFTPPHGGLLGWS
PQAQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHP
QA
Description: The E Coli expressed recombinant Hepatitis B Surface Antigen preS2 is a single non-glycosylated polypeptide chain containing 119 amino acids and having a molecular weight of 12.6 kDa. Sequence:
size :
0.05 mg
price :
315 USD
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!