product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
HBsAg adr, Hepatitis B Surface Antigen adr subtype, CHO
catalog :
MBS434102
quantity :
0.05 mg
price :
315 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS434102
products type :
Recombinant Protein
products full name :
HBsAg adr, Hepatitis B Surface Antigen adr subtype, CHO
products short name :
HBsAg adr
products name syn :
HBsAg adr recombinant protein; HBsAg adr Recombinant Protein; HBsAg adr Recombinant Protein
products gene name :
HBsAg
host :
CHO.
purity :
> 95% (by SDS-PAGE). Purified by proprietary chromatographic technique
concentration :
50 mug/300 mul in 20 mM phosphate, 154 mM sodium chloride.
storage stability :
Store at 4 degree C but should be kept at -20 degree C for long term storage. Non-hazardous.
tested application :
Western Blot (WB), ELISA (EIA)
app notes :
Immunochromatography, antibody ELISA, antigen, etc.
products categories :
Viral Recombinant Proteins; Hepatitis Virus
products description :
PTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLL PGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEW ASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFF CLWVYI(Genebank accession#, ACX36042).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSL
NFLGGAPTCPGQNSQS
Description: The CHO expressed recombinant Hepatitis B virus HBsAg adr full length monomeric protein contains 227 amino acids of the S-gene with a molecular weight of 24 kDa. Small amounts of dimmer and trimer forms also exist in the solution. The CHO expressed recombinant HBsAg adr full length monomeric protein contains 226 amino acids of the S-gene with a molecular weight of 25 kDa. Small amounts of dimmer and trimer forms also exist in the solution. Sequence:
size1 :
0.05 mg
price1 :
315 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!