MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSL
NFLGGTTVCLGQNSQS
Description: The Saccharomyces cerevisae expressed recombinant HBsAg ayw (full length) is a 24 kDa protein cloned from Hepatitis B virus 320 genome. HBsAg is the surface antigen of the Hepatitis-B-Virus and commonly referred to as the Australian Antigen. The recombinant HBsAg ayw full length monomeric protein contains 226 amino acids of the S-gene with a molecular weight of 25 kDa. Small amounts of dimmer and trimer forms also exist in the solution. Sequence:.

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- HBsAg adr, Hepatitis B Surface Antigen adr subtype, CHO | MBS434102
- HA (aa 18-529)(A/California/07/2009)(H1N1) | MBS434121
- HA (aa 18-530)(A/California/06/09)(H1N1) | MBS434122
- HA (H6N1)(A/northern shoveler/California/HKWF115/07) (aa 17-529) | MBS434125
- H3 (H3N2)(A/Brisbane/10/2007) (aa 18-530) | MBS434130