product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
HBsAg ayw, Hepatitis B Surface Antigen Ayw subtype, Saccharomyces
catalog :
MBS434096
quantity :
0.05 mg
price :
315 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS434096
products type :
Recombinant Protein
products full name :
HBsAg ayw, Hepatitis B Surface Antigen Ayw subtype, Saccharomyces
products short name :
HBsAg ayw
products name syn :
HBsAg ayw recombinant protein; HBsAg ayw Recombinant Protein; HBsAg ayw recombinant protein
products gene name :
HBsAg
host :
Saccharomyces cerevisae.
purity :
> 95% (by SDS-PAGE)
concentration :
50 mug/50 mul in 50 mM phosphate buffer pH7.2, 200 mM NaCl.
storage stability :
Store at 4 degree C for immediate use. Stable for 6 months from the date of shipment at -20 degree C. Non-hazardous.
tested application :
Western Blot (WB), ELISA (EIA), Immunogen
products categories :
Viral Recombinant Proteins; Hepatitis Virus
products description :
PTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLI PGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGKFLWEW ASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFF CLWVYI(Genebank accession#, CAA05872).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSL
NFLGGTTVCLGQNSQS
Description: The Saccharomyces cerevisae expressed recombinant HBsAg ayw (full length) is a 24 kDa protein cloned from Hepatitis B virus 320 genome. HBsAg is the surface antigen of the Hepatitis-B-Virus and commonly referred to as the Australian Antigen. The recombinant HBsAg ayw full length monomeric protein contains 226 amino acids of the S-gene with a molecular weight of 25 kDa. Small amounts of dimmer and trimer forms also exist in the solution. Sequence:.
size :
0.05 mg
price :
315 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!