product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
E2 (HCV) (amino acid 383-663), subtype 1b
catalog :
MBS434003
quantity :
0.05 mg
price :
350 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS434003
products type :
Recombinant Protein
products full name :
E2 (HCV) (amino acid 383-663), subtype 1b
products short name :
E2 (HCV)
products name syn :
HCV E2 protein; subtype 1b; E2 (HCV); Subtype 1b; Hepatitis C Virus E2 Recombinant Protein
other names :
Hepatitis C virus from Shanghai, complete genome; Genome polyprotein
products gene name :
E2
uniprot entry name :
Q6SCJ5_9HEPC
host :
293 cell culture
sequence length :
9577
sequence :
GQTRAVGGMQSHFTQRFVSLFSLGPAQKIQLVNTNGSWH
VNRTALNCNDSLQTGFIAALFYANRFNSSGCPERLASCR
PIDKFAQGWGPITYAKPDSPDQRPYCWHYAPQPCGIVPA
SEVCGPVYCFPSPVVVGTPIRFGVPTYTWGANETDVLLL
NNTRPPLGNWFGCTWMNATGFTKTCGGPPCNIGGVGNNA
LTCPTDCFRKHPEATYAKCGSGPWLTPRCMVDYPYRLWH
YPCTVNFTIFKVRMYVGGVERLNAACNWTRGERCNLEDR
DRSELS
purity :
> = 96% purity (by SDS-PAGE)
concentration :
1 ug/ul in PBS with less than 0.1% BSA and 25% glycerol
storage stability :
Store at -20 degree C. Stable for 6-months from the date of shipment when kept at 4 degree C. Non-hazardous. No MSDS required.
tested application :
Western Blot (WB), ELISA (EIA), Antigen.
other info1 :
Note: Viral protein purified from 293 cell culture.
other info2 :
Endotoxin Level: <0.01 EU per 1 mug of the protein by LAL test. Viral Protein: C-terminal 6xHis tagged HCV E2 protein (amino acid 383-663) (subtype 1b) (Genebank No. AY460204).
products categories :
Viral Recombinant Proteins; Hepatitis Virus
products description :
Description: 6xHis tagged HCV E2 protein (amino acid 383-663) (Genebank Accession No. AY460204) expressed in 293 cells. Viral protein purified from 293 cell culture. Introduction: The hepatitis C virus (HCV) is a small, enveloped, single-stranded, positive-sense RNA virus. HCV has a high rate of replication with approximately one trillion particles produced each day in an infected individual. Due to lack of proofreading by the HCV RNA polymerase, the HCV has an exceptionally high mutation rate, a factor that may help it elude the host's immune response. There are seven major genotypes of HCV with several subtypes within each genotype. The viral RNA codes for a large polyprotein of approx. 3100 amino acids, which is posttranslationally processed by cellular and viral proteases. The N-terminus encompasses the structural proteins core and two glycoproteins (E1, E2); the C-terminus encompasses the p7 protein and the nonstructural (NS) proteins NS2, NS3, NS4A, NS4B, NS5A and NS5B.
ncbi gi num :
38492204
ncbi acc num :
AAR22408.1
ncbi mol weight :
326,746 Da
size1 :
0.05 mg
price1 :
350 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!