protein

AKAP12 Peptide - middle region

MBS3246345

0.1 mg

150 USD

Blocking Peptide

AKAP12 Peptide - middle region

[AKAP12]

[A-kinase anchor protein 12 isoform 1; A-kinase anchor protein 12; A-kinase anchor protein 12; A-kinase anchoring protein 12; A-kinase anchor protein 250 kDa; AKAP 250; Gravin; Myasthenia gravis autoantigen]

[AKAP12]

[SSeCKS; AKAP250]

[AKAP12; AKAP12; SSeCKS; AKAP250; AKAP250; AKAP-12; AKAP 250]

AKA12_HUMAN

Human

1684

MLSSQERMKVQGSPLKKLFTSTGLKKLSGKKQKGKRGGG
DEESGEHTQVP
Synthetic peptide located within the following region:

Lyophilized powder

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Peptide

This is a synthetic peptide designed for use in combination with anti- AKAP12 Antibody, made. Target Description: The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein is expressed in endothelial cells, cultured fibroblasts, and osteosarcoma cells. It associates with protein kinases A and C and phosphatase, and serves as a scaffold protein in signal transduction. This protein and RII PKA colocalize at the cell periphery. This protein is a cell growth-related protein. Antibodies to this protein can be produced by patients with myasthenia gravis. Alternative splicing of this gene results in two transcript variants encoding different isoforms.

21493022

NP_005091.2

NM_005100.3

Q02952

185 kDa

G Protein Signaling Pathways (198849)

The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein is expressed in endothelial cells, cultured fibroblasts, and osteosarcoma cells. It associates with protein kinases A and C and phosphatase, and serves as a scaffold protein in signal transduction. This protein and RII PKA colocalize at the cell periphery. This protein is a cell growth-related protein. Antibodies to this protein can be produced by patients with myasthenia gravis. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

0.1 mg

150 USD