product summary
Loading...
company name :
MyBioSource
product type :
antibody
product name :
OLFR187 Antibody - C-terminal region
catalog :
MBS3224027
quantity :
0.1 mL
price :
335 USD
clonality :
polyclonal
host :
rabbit
conjugate :
nonconjugated
reactivity :
mouse
application :
western blot
more info or order :
image
image 1 :
Host: Rabbit. Target Name: OLFR187. Sample Tissue: Mouse Brain lysates. Antibody Dilution: 1ug/ml
product information
catalog number :
MBS3224027
products type :
Antibody
products full name :
OLFR187 Antibody - C-terminal region
products short name :
[OLFR187]
other names :
[Olfactory receptor 187; Olfactory receptor 187; olfactory receptor 187; olfactory receptor 187; Olfactory receptor 183-8]
products gene name :
[OLFR187]
products gene name syn :
[MOR183-8]
other gene names :
[Olfr187; Olfr187; MOR183-8; Mor183-8]
uniprot entry name :
OL187_MOUSE
clonality :
Polyclonal
host :
Rabbit
reactivity :
Tested: Mouse; Predicted: Mouse
sequence length :
308
sequence :
VHPASSEVDDQDMIDSLFYTVIIPVLNPIIYSLRNKQVI
DSLAKFLKRNV
Synthetic peptide located within the following region:
DSLAKFLKRNV
Synthetic peptide located within the following region:
purity :
Affinity purified
form :
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
storage stability :
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
tested application :
Western Blot (WB)
image1 heading :
Western Blot (WB)
other info1 :
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse OLFR187
products categories :
Polyclonal; Signaling Intermediate; Growth Factors & Hormones; Membrane Protein; Neuroscience; Signal Transduction; Membrane
products description :
Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
ncbi gi num :
81915283
ncbi acc num :
Q8VEX6.1
uniprot acc num :
Q8VEX6
ncbi mol weight :
35 kDa
ncbi pathways :
Odorant GPCRs Pathway (755425); Olfactory Transduction Pathway (83284); Olfactory Transduction Pathway (498)
ncbi summary :
Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008]
uniprot summary :
OR5H6: Odorant receptor (Potential). Belongs to the G-protein coupled receptor 1 family. Protein type: Membrane protein, multi-pass; Receptor, GPCR; GPCR, family 1; Membrane protein, integral. Cellular Component: integral to membrane; membrane; plasma membrane. Molecular Function: G-protein coupled receptor activity; odorant binding; olfactory receptor activity; signal transducer activity. Biological Process: G-protein coupled receptor protein signaling pathway; response to stimulus; sensory perception of smell; signal transduction
size1 :
0.1 mL
price1 :
335 USD
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!