antibody

CH25H Antibody - C-terminal region

MBS3216814

0.1 mL

365 USD

polyclonal

rabbit

nonconjugated

human, mouse, rat, cow, zebrafish

Antibody

CH25H Antibody - C-terminal region

[CH25H]

[cholesterol 25-hydroxylase; Cholesterol 25-hydroxylase; cholesterol 25-hydroxylase; cholesterol 25-hydroxylase; Cholesterol 25-monooxygenase; h25OH]

[CH25H]

[C25H]

[CH25H; CH25H; C25H; h25OH]

Polyclonal

Rabbit

Cow, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

272

VTLLGCHPLTTLTFHVVNIWLSVEDHSGYNFPWSTHRLV
PFGWYGGVVHH
Synthetic peptide located within the following region:

Affinity Purified

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

Western Blot (WB)

Western Blot

Homology: Cow: 93%; Goat: 83%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Yeast: 75%; Zebrafish: 86%. Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CH25H

Polyclonal; Membrane Protein;

This is a rabbit polyclonal antibody against CH25H. It was validated on Western Blot. Target Description: This is an intronless gene that is involved in cholesterol and lipid metabolism. The encoded protein is a membrane protein and contains clusters of histidine residues essential for catalytic activity. Unlike most other sterol hydroxylases, this enzyme is a member of a small family of enzymes that utilize diiron cofactors to catalyze the hydroxylation of hydrophobic substrates.

4502499

NP_003947

NM_003956

O95992

32kDa

Bile Acid And Bile Salt Metabolism Pathway (1270040); Metabolism Pathway (1269956); Metabolism Of Lipids And Lipoproteins Pathway (1270001); Primary Bile Acid Biosynthesis Pathway (82938); Primary Bile Acid Biosynthesis Pathway (299); Synthesis Of Bile Acids And Bile Salts Pathway (1270041)

This is an intronless gene that is involved in cholesterol and lipid metabolism. The encoded protein is a membrane protein and contains clusters of histidine residues essential for catalytic activity. Unlike most other sterol hydroxylases, this enzyme is a member of a small family of enzymes that utilize diiron cofactors to catalyze the hydroxylation of hydrophobic substrates. [provided by RefSeq, Jul 2008]

Catalyzes the formation of 25-hydroxycholesterol from cholesterol, leading to repress cholesterol biosynthetic enzymes (PubMed:9852097). Plays a key role in cell positioning and movement in lymphoid tissues: 25-hydroxycholesterol is an intermediate in biosynthesis of 7-alpha,25-dihydroxycholesterol (7-alpha,25-OHC), an oxysterol that acts as a ligand for the G protein-coupled receptor GPR183/EBI2, a chemotactic receptor for a number of lymphoid cells. May play an important role in regulating lipid metabolism by synthesizing a corepressor that blocks sterol regulatory element binding protein (SREBP) processing. In testis, production of 25-hydroxycholesterol by macrophages may play a role in Leydig cell differentiation.

0.1 mL

365 USD