ITGA2 Antibody - C-terminal region | MyBioSource MBS3216364 product information

product summary

company name :

MyBioSource

product type :

antibody

product name :

ITGA2 Antibody - C-terminal region

catalog :

MBS3216364

quantity :

0.1 mL

price :

335 USD

clonality :

polyclonal

host :

rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dog

application :

western blot, immunocytochemistry

more info or order :

MyBioSource product webpage

image

image 1 :

Sample Type :. HeLa cells Primary Antibody Dilution :. 1:150 Secondary Antibody :. Goat anti-rabbit-Alexa Fluor 488 Secondary Antibody Dilution :. 1:800 Color/Signal Descriptions :. Green: ITGA2. Blue: DAPI Gene Name :. ITGA2 Submitted by :. COCOLA Cinzia, Stem Cell Biology and Cancer Research Unit

image 2 :

WB Suggested Anti-ITGA2 Antibody. Titration: 1.0 ug/ml. Positive Control: HT1080 Whole CellITGA2 is supported by BioGPS gene expression data to be expressed in HT1080

product information

catalog number :

MBS3216364

products type :

Antibody

products full name :

ITGA2 Antibody - C-terminal region

products short name :

[ITGA2]

products name syn :

[UBC; PDIA3; ATF2; ALB; ERGIC1; SHARPIN; ITGB1; PSMD4; AUP1; ITGA2; LAMA1; CD9; HSPG2; MMP1; COL8A1; COL1A2; COL1A1; ACTA1; RABIF; CD46]

other names :

[integrin alpha-2; Integrin alpha-2; integrin alpha-2; integrin subunit alpha 2; CD49 antigen-like family member B; Collagen receptor; Platelet membrane glycoprotein Ia; GPIa; VLA-2 subunit alpha]

products gene name :

[ITGA2]

products gene name syn :

[BR; CD49B; GPIa; VLA-2; VLAA2; BDPLT9]

other gene names :

[ITGA2; ITGA2; BR; GPIa; CD49B; HPA-5; VLA-2; VLAA2; CD49B; GPIa]

uniprot entry name :

ITA2_HUMAN

clonality :

Polyclonal

host :

Rabbit

reactivity :

Reacts with : Human. Predicted: Cow, Dog, Guinea Pig, Horse, Mouse, Pig, Rabbit, Rat

sequence length :

1181

sequence :

LQNLQNQASLSFQALSESQEENKADNLVNLKIPLLYDAE
IHLTRSTNINF
Synthetic peptide located within the following region:

purity :

Affinity Purified

form :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

concentration :

Lot dependent within range: 100 ul at 0.5-1 mg/ml "Please refer to the vial's label.

storage stability :

For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

tested application :

Immunofluorescence (IF), Western Blot (WB)

image1 heading :

Immunofluorescence (IF)

image2 heading :

Western Blot (WB)

other info1 :

Homology: Cow: 92%; Dog: 93%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 86%; Rat: 86%. Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ITGA2

products categories :

Polyclonal; Signaling Intermediate; Cell Adhesion; Membrane Protein;

products description :

This is a rabbit polyclonal antibody against ITGA2. It was validated on Western Blot. Target Description: This gene product belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane glycoproteins composed of a distinct alpha chain and a common beta chain. They are found on a wide variety of cell types including, T cells, fibroblasts and platelets. Integrins are involved in cell adhesion and also participate in cell-surface mediated signalling.

ncbi gi num :

116295258

ncbi acc num :

NP_002194

ncbi gb acc num :

NM_002203

uniprot acc num :

P17301

ncbi mol weight :

126kDa

ncbi pathways :

Arf6 Trafficking Events Pathway (137954); Arrhythmogenic Right Ventricular Cardiomyopathy Pathway (672454); Arrhythmogenic Right Ventricular Cardiomyopathy (ARVC) Pathway (117293); Arrhythmogenic Right Ventricular Cardiomyopathy (ARVC) Pathway (116129); Axon Guidance Pathway (105688); CHL1 Interactions Pathway (161007); CXCR4-mediated Signaling Events Pathway (137910); Developmental Biology Pathway (477129); Dilated Cardiomyopathy Pathway (121494); Dilated Cardiomyopathy Pathway (121285)

ncbi summary :

This gene encodes the alpha subunit of a transmembrane receptor for collagens and related proteins. The encoded protein forms a heterodimer with a beta subunit and mediates the adhesion of platelets and other cell types to the extracellular matrix. Loss of the encoded protein is associated with bleeding disorder platelet-type 9. Antibodies against this protein are found in several immune disorders, including neonatal alloimmune thrombocytopenia. This gene is located adjacent to a related alpha subunit gene. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]

uniprot summary :

ITGA2: Integrin alpha-2/beta-1 is a receptor for laminin, collagen, collagen C-propeptides, fibronectin and E-cadherin. It recognizes the proline-hydroxylated sequence G-F-P-G-E-R in collagen. It is responsible for adhesion of platelets and other cells to collagens, modulation of collagen and collagenase gene expression, force generation and organization of newly synthesized extracellular matrix. Belongs to the integrin alpha chain family. Protein type: Motility/polarity/chemotaxis; Cell adhesion; Membrane protein, integral; Receptor, misc. Chromosomal Location of Human Ortholog: 5q11.2. Cellular Component: cell surface; focal adhesion; perinuclear region of cytoplasm; plasma membrane; nerve terminal; integrin complex; nucleus; external side of plasma membrane. Molecular Function: integrin binding; collagen binding; viral receptor activity; protein binding; protein heterodimerization activity; metal ion binding; laminin binding. Biological Process: axon guidance; entry of virus into host cell; extracellular matrix organization and biogenesis; response to muscle activity; positive regulation of positive chemotaxis; positive regulation of cell adhesion; positive regulation of translation; positive regulation of leukocyte migration; cell-matrix adhesion; positive regulation of smooth muscle cell proliferation; positive regulation of collagen binding; positive regulation of collagen biosynthetic process; positive regulation of cell projection organization and biogenesis; mesodermal cell differentiation; positive regulation of smooth muscle cell migration; response to L-ascorbic acid; response to organic cyclic substance; establishment of protein localization; mammary gland development; positive regulation of smooth muscle contraction; cell adhesion; positive regulation of DNA binding; substrate-bound cell migration; integrin-mediated signaling pathway; response to drug; skin morphogenesis; hypotonic response; cell-substrate adhesion; cellular response to hormone stimulus; cell proliferation; detection of mechanical stimulus involved in sensory perception of pain; organ morphogenesis; response to hypoxia; cell adhesion mediated by integrin; positive regulation of phagocytosis, engulfment; blood coagulation; positive regulation of transmission of nerve impulse; positive regulation of inflammatory response; response to amine stimulus. Disease: Bleeding Disorder, Platelet-type, 9

size1 :

0.1 mL

price1 :

335 USD

more info or order :

MyBioSource product webpage