product summary
Loading...
company name :
MyBioSource
product type :
antibody
product name :
CD70 antibody - N-terminal region
catalog :
MBS3215177
quantity :
0.1 mL
price :
335 USD
clonality :
polyclonal
host :
rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot
more info or order :
image
image 1 :
MyBioSource MBS3215177 image 1
WB Suggested Anti-CD70 Antibody. Titration: 1.0 ug/ml. Positive Control: ACHN Whole CellCD70 is supported by BioGPS gene expression data to be expressed in ACHN
product information
catalog number :
MBS3215177
products type :
Antibody
products full name :
CD70 antibody - N-terminal region
products short name :
[CD70]
products name syn :
[CD27L; CD27LG; TNFSF7]
other names :
[CD70 antigen isoform 1; CD70 antigen; CD70 antigen; CD70 molecule; CD27 ligand; CD27-L; Tumor necrosis factor ligand superfamily member 7]
products gene name :
[CD70]
products gene name syn :
[CD27L; CD27LG; TNFSF7]
other gene names :
[CD70; CD70; CD27L; LPFS3; CD27-L; CD27LG; TNFSF7; TNLG8A; CD27L; CD27LG; TNFSF7; CD27-L]
uniprot entry name :
CD70_HUMAN
clonality :
Polyclonal
host :
Rabbit
reactivity :
Reactivity: Human. Predicted Species Reactivity: Cow, Guinea Pig, Horse, Human, Rabbit
sequence length :
193
sequence :
VICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQ
DPRLYWQGGPA
Synthetic peptide located within the following region:
purity :
Affinity Purified
form :
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
concentration :
100 ul at 0.5-1 mg/ml
storage stability :
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
tested application :
Western Blot (WB)
image1 heading :
Western Blot (WB)
other info1 :
Homology: Cow: 85%; Guinea Pig: 85%; Horse: 77%; Human: 100%; Rabbit: 85%. Protein Name: CD70 antigen
products categories :
Polyclonal; Various;
products description :
This is a rabbit polyclonal antibody against CD70. It was validated on Western Blot. Target Description: The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes. It induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis.
ncbi gi num :
4507605
ncbi acc num :
NP_001243
ncbi gb acc num :
NM_001252
uniprot acc num :
P32970
ncbi mol weight :
21kDa
ncbi summary :
The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes. It induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis. [provided by RefSeq, Jul 2008]
uniprot summary :
CD70: Cytokine that binds to CD27. Plays a role in T-cell activation. Induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells. Belongs to the tumor necrosis factor family. Protein type: Cytokine; Membrane protein, integral. Chromosomal Location of Human Ortholog: 19p13. Cellular Component: extracellular space; integral to plasma membrane; plasma membrane. Molecular Function: protein binding; protease binding; cytokine activity; tumor necrosis factor receptor binding; receptor binding. Biological Process: cell proliferation; cell-cell signaling; immune response; signal transduction
size1 :
0.1 mL
price1 :
335 USD
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!