MERTK Antibody - N-terminal region | MyBioSource MBS3214157 product information

product summary

company name :

MyBioSource

product type :

antibody

product name :

MERTK Antibody - N-terminal region

catalog :

MBS3214157

quantity :

0.1 mL

price :

335 USD

clonality :

polyclonal

host :

rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dog

application :

western blot

more info or order :

MyBioSource product webpage

image

image 1 :

Host: Rabbit. Target Name: MERTK. Sample Tissue: Human COLO205 Whole Cell. Antibody Dilution: 1ug/ml

product information

catalog number :

MBS3214157

products type :

Antibody

products full name :

MERTK Antibody - N-terminal region

products short name :

[MERTK]

other names :

[tyrosine-protein kinase Mer; Tyrosine-protein kinase Mer; tyrosine-protein kinase Mer; MER proto-oncogene, tyrosine kinase; Proto-oncogene c-Mer; Receptor tyrosine kinase MerTK]

products gene name :

[MERTK]

products gene name syn :

[MERTK; MER;]

other gene names :

[MERTK; MERTK; MER; RP38; c-Eyk; c-mer; Tyro12; MER]

uniprot entry name :

MERTK_HUMAN

clonality :

Polyclonal

host :

Rabbit

reactivity :

Tested: Human; Predicted: Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat

sequence length :

999

sequence :

PEPVNIFWVQNSSRVNEQPEKSPSVLTVPGLTEMAVFSC
EAHNDKGLTVS
Synthetic peptide located within the following region:

purity :

Affinity purified

form :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

concentration :

Batch dependent within range: 100 ul at 0.5 - 1 mg/ml

storage stability :

For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

tested application :

Western Blot (WB)

image1 heading :

Western Blot (WB)

other info1 :

Protein Size (# AA): 999 amino acids. Predicted Homology Based on Immunogen Sequence: Cow: 79%; Dog: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 93%; Rat: 93%. Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human MERTK. Protein Interactions: UBC; HSP90AA1; TNK2; MERTK; ITGB5; NEDD4L; IKBKG; LMO4; BMPR2; GAS6; VAV1; GRB2

products categories :

Polyclonal; Protein Kinases; Membrane Protein; Disease Related;

products description :

This is a rabbit polyclonal antibody against MERTK. It was validated on Western Blot. Target Description: This gene is a member of the MER/AXL/TYRO3 receptor kinase family and encodes a transmembrane protein with two fibronectin type-III domains, two Ig-like C2-type (immunoglobulin-like) domains, and one tyrosine kinase domain. Mutations in this gene have been associated with disruption of the retinal pigment epithelium (RPE) phagocytosis pathway and onset of autosomal recessive retinitis pigmentosa (RP).

ncbi gi num :

66932918

ncbi acc num :

NP_006334

ncbi gb acc num :

NM_006343.2

uniprot acc num :

Q12866

ncbi mol weight :

109kDa

ncbi pathways :

Cell Surface Interactions At The Vascular Wall Pathway (106062); Hemostasis Pathway (106028)

ncbi summary :

This gene is a member of the MER/AXL/TYRO3 receptor kinase family and encodes a transmembrane protein with two fibronectin type-III domains, two Ig-like C2-type (immunoglobulin-like) domains, and one tyrosine kinase domain. Mutations in this gene have been associated with disruption of the retinal pigment epithelium (RPE) phagocytosis pathway and onset of autosomal recessive retinitis pigmentosa (RP). [provided by RefSeq, Jul 2008]

uniprot summary :

Mer: a proto-oncogene receptor tyrosine-protein kinase of the Axl family. Binds several ligands including LGALS3, Tubby, TULP1 or GAS6. Regulates many physiological processes including cell survival, migration, differentiation, and phagocytosis of apoptotic cells (efferocytosis). Functions in the retinal pigment epithelium (RPE) as a regulator of rod outer segments fragments phagocytosis. Plays also an important role in inhibition of Toll-like receptors (TLRs)-mediated innate immune response by activating STAT1, which selectively induces production of suppressors of cytokine signaling SOCS1 and SOCS3. Protein type: Protein kinase, TK; EC 2.7.10.1; Oncoprotein; Membrane protein, integral; Kinase, protein; Protein kinase, tyrosine (receptor); TK group; Axl family. Chromosomal Location of Human Ortholog: 2q14.1. Cellular Component: extracellular space; photoreceptor outer segment; integral to plasma membrane; cytoplasm; plasma membrane. Molecular Function: protein binding; transmembrane receptor protein tyrosine kinase activity; ATP binding. Biological Process: platelet activation; negative regulation of lymphocyte activation; peptidyl-tyrosine phosphorylation; vagina development; protein amino acid phosphorylation; phagocytosis; cell surface receptor linked signal transduction; cell-cell signaling; natural killer cell differentiation; retina development in camera-type eye; positive regulation of phagocytosis; protein kinase B signaling cascade; spermatogenesis; blood coagulation; leukocyte migration; apoptotic cell clearance; secretion by cell. Disease: Retinitis Pigmentosa 38

size1 :

0.1 mL

price1 :

335 USD

more info or order :

MyBioSource product webpage