product summary
Loading...
company name :
MyBioSource
product type :
antibody
product name :
MPP7 antibody - N-terminal region
catalog :
MBS3211216
quantity :
0.1 mL
price :
365 USD
clonality :
polyclonal
host :
rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, dog
application :
western blot
more info or order :
MyBioSource product webpage
image
image 1 :
MyBioSource MBS3211216 image 1
WB Suggested Anti-MPP7 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: HT1080 cell lysate
product information
catalog number :
MBS3211216
products type :
Antibody
products full name :
MPP7 antibody - N-terminal region
products short name :
[MPP7]
other names :
[MAGUK p55 subfamily member 7; MAGUK p55 subfamily member 7; MAGUK p55 subfamily member 7; membrane palmitoylated protein 7]
products gene name :
[MPP7]
products gene name syn :
[FLJ32798; RP11-218D6.5]
other gene names :
[MPP7; MPP7]
uniprot entry name :
MPP7_HUMAN
clonality :
Polyclonal
host :
Rabbit
reactivity :
Tested: Human; Predicted: Cow, Dog, Horse, Human, Mouse, Rabbit, Rat
sequence length :
576
sequence :
MPALSTGSGSDTGLYELLAALPAQLQPHVDSQEDLTFLW
DMFGEKSLHSL
Synthetic peptide located within the following region:
purity :
Affinity Purified
form :
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
concentration :
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
storage stability :
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
tested application :
Western Blot (WB)
image1 heading :
Western Blot (WB)
other info1 :
Protein Size (#AA): 576 amino acids. Protein Interactions: AMOT; Wwtr1; Yap1; UBC. Blocking Peptide: For anti-MPP7 (MBS3211216) antibody is MBS3236168 . Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MPP7. Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
other info2 :
Replacement Item: This antibody may replace item sc-163089 from Santa Cruz Biotechnology.
products categories :
Polyclonal; Developmental Biology; Signal Transduction; Various; Membrane
products description :
This is a rabbit polyclonal antibody against MPP7. It was validated on Western Blot using a cell lysate as a positive control. Target Description: MPP7 acts as an important adapter that promotes epithelial cell polarity and tight junction formation via its interaction with DLG1. MPP7 is involved in the assembly of protein complexes at sites of cell-cell contact.Membrane-associated guanylate kinases (MAGUKs) are important adaptor proteins involved in the assembly of protein complexes at sites of cell-cell contact. They are found in synapses, adherens junctions, and tight junctions. All MAGUKs contain at least 1 PDZ domain, an SH3 domain, and a GUK domain, and many contain 1 or 2 L27 domains, which are involved in multimerization of MAGUKs. MPP7 belongs to the p55 stardust subfamily of MAGUKs, which is named for a Drosophila gene required for establishment of cell polarity in the developing fly embryo (Bohl et al., 2007 [PubMed 17237226]).[supplied by OMIM].
ncbi gi num :
111154074
ncbi acc num :
NP_775767
ncbi gb acc num :
NM_173496
uniprot acc num :
Q5T2T1
ncbi mol weight :
65kDa
ncbi summary :
The protein encoded by this gene is a member of the p55 Stardust family of membrane-associated guanylate kinase (MAGUK) proteins, which function in the establishment of epithelial cell polarity. This family member forms a complex with the polarity protein DLG1 (discs, large homolog 1) and facilitates epithelial cell polarity and tight junction formation. Polymorphisms in this gene are associated with variations in site-specific bone mineral density (BMD). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]
uniprot summary :
MPP7: Acts as an important adapter that promotes epithelial cell polarity and tight junction formation via its interaction with DLG1. Involved in the assembly of protein complexes at sites of cell-cell contact. Belongs to the MAGUK family. Protein type: Adaptor/scaffold. Chromosomal Location of Human Ortholog: 10p12.1. Cellular Component: adherens junction; tight junction; mitochondrion; cell junction. Molecular Function: protein domain specific binding; protein binding; protein heterodimerization activity; protein complex scaffold. Biological Process: positive regulation of protein complex assembly; positive regulation of signal transduction; establishment of cell polarity
size1 :
0.1 mL
price1 :
365 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!