PCDHGC4 antibody - N-terminal region | MyBioSource MBS3209429 product information

product summary

company name :

MyBioSource

product type :

antibody

product name :

PCDHGC4 antibody - N-terminal region

catalog :

MBS3209429

quantity :

0.1 mL

price :

335 USD

clonality :

polyclonal

host :

rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunohistochemistry

more info or order :

MyBioSource product webpage

image

image 1 :

PCDHGC4 antibody - N-terminal region . Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue . Observed Staining: Cytoplasm of pneumocytes. Primary Antibody Concentration: 1:100 . Secondary Antibody: Donkey anti-Rabbit-Cy3 . Secondary Antibody Concentration: 1:200 . Magnification: 20X . Exposure Time: 0.5 - 2.0 sec

image 2 :

WB Suggested Anti-PCDHGC4 Antibody Titration: 0.2-1 ug/ml. Positive Control: 293T cell lysate

product information

catalog number :

MBS3209429

products type :

Antibody

products full name :

PCDHGC4 antibody - N-terminal region

products short name :

[PCDHGC4]

other names :

[protocadherin gamma-C4 isoform 1; Protocadherin gamma-C4; protocadherin gamma-C4; protocadherin gamma subfamily C, 4]

products gene name :

[PCDHGC4]

products gene name syn :

[MGC119489; PCDH-GAMMA-C4]

other gene names :

[PCDHGC4; PCDHGC4; PCDH-GAMMA-C4; PCDH-gamma-C4]

clonality :

Polyclonal

host :

Rabbit

reactivity :

Tested: Human. Predicted: Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish

purity :

Affinity Purified

form :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

concentration :

Batch dependent within range: 100 ul at 0.5 - 1 mg/ml

storage stability :

For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

tested application :

Western Blot (WB), Immunohistochemistry (IHC)

image1 heading :

Immunohistochemistry (IHC)

image2 heading :

Western Blot (WB)

other info1 :

Blocking Peptide: For anti-PCDHGC4 (MBS3209429) antibody is Catalog# MBS3234388 . Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PCDHGC4. Predicted Homology Based on Immunogen Sequence: Horse: 100%; Human: 100%; Mouse: 100%; Pig: 91%; Rabbit: 79%; Rat: 100%; Zebrafish: 100%
VKKRSDGSLVPELLLEKPLDREKQSDYRLVLTAVDGGNP
PRSGTAELRVS.
Protein Size (# AA): 938 amino acids. Peptide Sequence: Synthetic peptide located within the following region:

other info2 :

Replacement Item: This antibody may replace item sc-106954 from Santa Cruz Biotechnology.

products categories :

Polyclonal; Signal Proteins; Cell Adhesion; Membrane Protein; Membrane

products description :

PCDHGC4 is a single-pass type I membrane protein. It contains 6 cadherin domains.PCDHGC4 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.This gene is a member of the protocadherin gamma gene cluster, one of three related clusters tandemly linked on chromosome five. These gene clusters have an immunoglobulin-like organization, suggesting that a novel mechanism may be involved in their regulation and expression. The gamma gene cluster includes 22 genes divided into 3 subfamilies. Subfamily A contains 12 genes, subfamily B contains 7 genes and 2 pseudogenes, and the more distantly related subfamily C contains 3 genes. The tandem array of 22 large, variable region exons are followed by a constant region, containing 3 exons shared by all genes in the cluster. Each variable region exon encodes the extracellular region, which includes 6 cadherin ectodomains and a transmembrane region. The constant region exons encode the common cytoplasmic region. These neural cadherin-like cell adhesion proteins most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been described for the gamma cluster genes.

ncbi gi num :

11128025

ncbi acc num :

NP_061751

ncbi gb acc num :

NM_018928

uniprot acc num :

Q9Y5F7

ncbi mol weight :

98kDa

ncbi summary :

This gene is a member of the protocadherin gamma gene cluster, one of three related clusters tandemly linked on chromosome five. These gene clusters have an immunoglobulin-like organization, suggesting that a novel mechanism may be involved in their regulation and expression. The gamma gene cluster includes 22 genes divided into 3 subfamilies. Subfamily A contains 12 genes, subfamily B contains 7 genes and 2 pseudogenes, and the more distantly related subfamily C contains 3 genes. The tandem array of 22 large, variable region exons are followed by a constant region, containing 3 exons shared by all genes in the cluster. Each variable region exon encodes the extracellular region, which includes 6 cadherin ectodomains and a transmembrane region. The constant region exons encode the common cytoplasmic region. These neural cadherin-like cell adhesion proteins most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been described for the gamma cluster genes. [provided by RefSeq, Jul 2008]

uniprot summary :

Potential calcium-dependent cell-adhesion protein. May be involved in the establishment and maintenance of specific neuronal connections in the brain.

size1 :

0.1 mL

price1 :

335 USD

more info or order :

MyBioSource product webpage