MYBPC3 Antibody - C-terminal region | MyBioSource MBS3205809 product information

product summary

company name :

MyBioSource

product type :

antibody

product name :

MYBPC3 Antibody - C-terminal region

catalog :

MBS3205809

quantity :

0.1 mL

price :

335 USD

clonality :

polyclonal

host :

rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dog

application :

western blot

more info or order :

MyBioSource product webpage

image

image 1 :

Host: Rabbit. Target Name: MYBPC3. Sample Type: MCF7 Whole cell lysates. Antibody Dilution: 1.0ug/ml

product information

catalog number :

MBS3205809

products type :

Antibody

products full name :

MYBPC3 Antibody - C-terminal region

products short name :

[MYBPC3]

other names :

[myosin-binding protein C, cardiac-type; Myosin-binding protein C, cardiac-type; myosin-binding protein C, cardiac-type; myosin binding protein C, cardiac; C-protein, cardiac muscle isoform]

products gene name :

[MYBPC3]

products gene name syn :

[FHC; CMH4; CMD1MM; LVNC10; MYBP-C]

other gene names :

[MYBPC3; MYBPC3; FHC; CMH4; CMD1MM; LVNC10; MYBP-C; Cardiac MyBP-C]

uniprot entry name :

MYPC3_HUMAN

clonality :

Polyclonal

host :

Rabbit

reactivity :

Tested: Human; Predicted: Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat

sequence length :

365

sequence :

KGKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQP
AFTGSYRCEVS
Synthetic peptide located within the following region:

purity :

Affinity Purified

form :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

concentration :

Batch dependent within range: 100 ul at 0.5-1 mg/ml

storage stability :

For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

tested application :

Western Blot (WB)

image1 heading :

Western Blot (WB)

other info1 :

Protein Size (#AA): 365 amino acids. Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 86%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%. Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human MYBPC3

other info2 :

Replacement Item: This antibody may replace item sc-112857 from Santa Cruz Biotechnology

products categories :

Polyclonal; Various;

products description :

This is a rabbit polyclonal antibody against MYBPC3. It was validated on Western Blot. Target Description: MYBPC3 encodes the cardiac isoform of myosin-binding protein C. Myosin-binding protein C is a myosin-associated protein found in the cross-bridge-bearing zone (C region) of A bands in striated muscle. MYBPC3, the cardiac isoform, is expressed exclussively in heart muscle. Regulatory phosphorylation of the cardiac isoform in vivo by cAMP-dependent protein kinase (PKA) upon adrenergic stimulation may be linked to modulation of cardiac contraction. Mutations in MYBPC3 are one cause of familial hypertrophic cardiomyopathy.

ncbi gi num :

148596957

ncbi acc num :

NP_000247.2

ncbi gb acc num :

NM_000256.3

uniprot acc num :

Q14896

ncbi mol weight :

40kDa

ncbi pathways :

Dilated Cardiomyopathy Pathway (121494); Dilated Cardiomyopathy Pathway (121285); Hypertrophic Cardiomyopathy (HCM) Pathway (114229); Hypertrophic Cardiomyopathy (HCM) Pathway (106591); Muscle Contraction Pathway (106261); Striated Muscle Contraction Pathway (198903); Striated Muscle Contraction Pathway (106262)

ncbi summary :

MYBPC3 encodes the cardiac isoform of myosin-binding protein C. Myosin-binding protein C is a myosin-associated protein found in the cross-bridge-bearing zone (C region) of A bands in striated muscle. MYBPC3, the cardiac isoform, is expressed exclussively in heart muscle. Regulatory phosphorylation of the cardiac isoform in vivo by cAMP-dependent protein kinase (PKA) upon adrenergic stimulation may be linked to modulation of cardiac contraction. Mutations in MYBPC3 are one cause of familial hypertrophic cardiomyopathy. [provided by RefSeq, Jul 2008]

uniprot summary :

MYBPC3: Thick filament-associated protein located in the crossbridge region of vertebrate striated muscle a bands. In vitro it binds MHC, F-actin and native thin filaments, and modifies the activity of actin-activated myosin ATPase. It may modulate muscle contraction or may play a more structural role. Belongs to the immunoglobulin superfamily. MyBP family. Protein type: Myosin-binding. Chromosomal Location of Human Ortholog: 11p11.2. Cellular Component: sarcomere; striated muscle thick filament; cytosol; A band. Molecular Function: identical protein binding; ATPase activator activity; myosin binding; structural constituent of muscle; metal ion binding; titin binding; actin binding; myosin heavy chain binding. Biological Process: heart morphogenesis; regulation of heart rate; positive regulation of ATPase activity; regulation of muscle filament sliding; regulation of striated muscle contraction; ventricular cardiac muscle morphogenesis; sarcomere organization; cell adhesion; myosin filament assembly; muscle filament sliding; cardiac muscle contraction. Disease: Left Ventricular Noncompaction 10; Cardiomyopathy, Familial Hypertrophic, 4

size1 :

0.1 mL

price1 :

335 USD

more info or order :

MyBioSource product webpage