SOX10 Antibody - middle region | MyBioSource MBS3201449 product information

product summary

company name :

MyBioSource

product type :

antibody

product name :

SOX10 Antibody - middle region

catalog :

MBS3201449

quantity :

0.1 mL

price :

365 USD

clonality :

polyclonal

host :

rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dog

application :

western blot, immunohistochemistry

more info or order :

MyBioSource product webpage

image

image 1 :

Sample Type: human optic nerves and spinal cord. A/[IHC-PZ] (optimal processing). human optic nerve (short post mortem interval) fixed by immersion in zinc-based fixative (BD Pharmingen 552658), processed to minimize antigen loss (shortened protocol, reduced exposure to high temperature); embedded in paraffin wax; sectioned at 3 microns. A2/[IHC-PZ + FF]. As above for initial fixation then post-fixed in 10% buffered formalin for 5 days. B/ [IHC-P]. human optic nerve and spinal cord fixed in 10% buffered formalin (relatively short post mortem interval and fixation duration); standard processing; embedded in paraffin wax; sectioned at 3 microns. Controls. Negative: omission of primary. Positive: Olig2 reactivity was in comparison with antibody from Prof Charles Stiles/ Dr John Alberta (DF308; N terminal Olig2) used at 1:10000 (IHC-PZ); 1:4000 (IHC-P)

image 2 :

Immunohistochemistry with Kidney lysate tissue at an antibody concentration of 4-8ug/ml using anti-SOX10 antibody

image 3 :

Immunohistochemistry with Skin tissue at an antibody concentration of 4-8ug/ml using anti-SOX10 antibody

product information

catalog number :

MBS3201449

products type :

Antibody

products full name :

SOX10 Antibody - middle region

products short name :

[SOX10]

other names :

[transcription factor SOX-10; Transcription factor SOX-10; transcription factor SOX-10; SRY-box 10]

products gene name :

[SOX10]

products gene name syn :

[DOM; MGC15649; WS2E; WS4; PCWH; WS4C]

other gene names :

[SOX10; SOX10; DOM; WS4; PCWH; WS2E; WS4C]

clonality :

Polyclonal

host :

Rabbit

reactivity :

Reactivity: Human. Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat

sequence length :

466

sequence :

PGGEAEQGGTAAIQAHYKSAHLDHRHPGEGSPMSDGNPE
HPSGQSHGPPT
Synthetic peptide located within the following region:

purity :

Affinity Purified

form :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

storage stability :

For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

tested application :

Immunohistochemistry (IHC), Western Blot (WB)

app notes :

Blocking Peptide: please indquire

image1 heading :

Immunohistochemistry (IHC)

image2 heading :

Immunohistochemistry (IHC)

image3 heading :

Immunohistochemistry (IHC)

image4 heading :

Western Blot (WB)

image4 description :

Host: Rabbit. Target Name: SOX10. Sample Tissue: Human MCF7 Whole Cell. Antibody Dilution: 1ug/ml

image5 heading :

Western Blot (WB)

image5 description :

Host: Rabbit. Target Name: SOX10. Sample Type: HepG2 Whole Cell lysates. Antibody Dilution: 0.5ug/ml

other info1 :

Homology: Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 86%. Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SOX10

products categories :

Polyclonal; Transcription Factor; Transcription Regulation; Transcription Regulation; Cell Biology; Chromatin & Nuclear Signaling; Developmental Biology; Immunology; Disease Related; Immunohistochemistry; Cell Structure; Transcription Factors; Cell Differ

products description :

SOX10 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. This protein may act as a transcriptional activator after forming a protein complex with other proteins. It acts as a nucleocytoplasmic shuttle protein and is important for neural crest and peripheral nervous system development. Mutations in this gene are associated with Waardenburg-Shah and Waardenburg-Hirschsprung disease.

ncbi gi num :

5902104

ncbi acc num :

NP_008872

ncbi gb acc num :

NM_006941

uniprot acc num :

P56693

ncbi mol weight :

50kDa

ncbi pathways :

Neural Crest Differentiation Pathway (672460)

ncbi summary :

This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional activator after forming a protein complex with other proteins. This protein acts as a nucleocytoplasmic shuttle protein and is important for neural crest and peripheral nervous system development. Mutations in this gene are associated with Waardenburg-Shah and Waardenburg-Hirschsprung disease. [provided by RefSeq, Jul 2008]

uniprot summary :

SOX10: Transcription factor that seems to function synergistically with the POU domain protein TST-1/OCT6/SCIP. Could confer cell specificity to the function of other transcription factors in developing and mature glia. Defects in SOX10 are the cause of Waardenburg syndrome type 2E (WS2E). WS2 is a genetically heterogeneous, autosomal dominant disorder characterized by sensorineural deafness, pigmentary disturbances, and absence of dystopia canthorum. The frequency of deafness is higher in WS2 than in WS1. Defects in SOX10 are a cause of Waardenburg syndrome type 4C (WS4C); also known as Waardenburg-Shah syndrome. WS4C is characterized by the association of Waardenburg features (depigmentation and deafness) and the absence of enteric ganglia in the distal part of the intestine (Hirschsprung disease). Defects in SOX10 are the cause of peripheral demyelinating neuropathy, central dysmyelinating leukodystrophy, Waardenburg syndrome, and Hirschsprung disease (PCWH); also called neurologic variant of Waardenburg-Shah syndrome. PCWH is a rare, complex and more severe neurocristopathy that includes features of 4 distinct syndromes: peripheral demyelinating neuropathy, central dysmyelinating leukodystrophy, Waardenburg syndrome, and Hirschsprung disease. Protein type: Cell development/differentiation; DNA-binding; Transcription factor. Chromosomal Location of Human Ortholog: 22q13.1. Cellular Component: nucleoplasm; nucleus. Molecular Function: identical protein binding; protein binding; transcription coactivator activity. Biological Process: anatomical structure morphogenesis; regulation of transcription from RNA polymerase II promoter. Disease: Peripheral Demyelinating Neuropathy, Central Dysmyelination, Waardenburg Syndrome, And Hirschsprung Disease; Waardenburg Syndrome, Type 2e; Waardenburg Syndrome, Type 4c

size1 :

0.1 mL

price1 :

365 USD

more info or order :

MyBioSource product webpage