product summary
Loading...
company name :
MyBioSource
product type :
antibody
product name :
MAb to beta-Defensin-1 (a.a. 1-36)
catalog :
MBS311954
quantity :
0.01 mg
price :
260 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
M11-14b-D10
reactivity :
human
application :
western blot, ELISA, enzyme immunoassay, immunohistochemistry - paraffin section
more info or order :
MyBioSource product webpage
citations: 1
Published Application/Species/Sample/DilutionReference
  • immunohistochemistry - paraffin section; human; 1:800; loading ...; fig 2b
Hong S, Kim K, Lee T, Park E, Kim M, Myung S. A role of human beta defensin-1 in predicting prostatic adenocarcinoma in cases of false-negative biopsy. APMIS. 2017;: pubmed publisher
product information
catalog number :
MBS311954
products type :
Antibody
products full name :
MAb to beta-Defensin-1 (a.a. 1-36)
products short name :
Defensin, beta-1 (a.a. 1-36)
products name syn :
Monoclonal Antibody to Human Defensin beta-1 (amino acids 1-36)
other names :
Defensin, beta 1; Beta-defensin 1; beta-defensin 1; BD-1; beta-defensin-1; OTTHUMP00000159500; defensin, beta 1; Defensin, beta 1
other gene names :
DEFB1; DEFB1; BD1; HBD1; DEFB-1; DEFB101; MGC51822; BD1; HBD1
uniprot entry name :
DEFB1_HUMAN
clonality :
Monoclonal
isotype :
IgG1
clone :
M11-14b-D10
host :
Host: Mouse. Source: Cell Culture
reactivity :
Human
specificity :
Defensin, beta-1 (a.a. 1-36). Synthetic human beta-Defensin 1 (a.a. 1-36).
purity :
Protein A chromatography
form :
Purified, Lyophilized. Reconstitute in 10ul double distilled water.
concentration :
1mg/ml (prior to lyophilization)
storage stability :
Store lyophilized product at 2 to 8 degree C. After reconstitution, store at -20 degree C. Avoid multiple freeze/thaw cycles.
tested application :
EIA/ELISA, Western Blot
other info1 :
Immunogen: Synthetic human beta-Defensin 1 (a.a. 1-36). (DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK). Affinity Constant: Not determined.
other info2 :
Buffer: Lyophilized from 50mM Tris, pH 7.4. Preservative: No. Lyophilized: Yes. Important Note: Vial Contains Small Quantity. Centrifuge Product Before Opening!
products categories :
Monoclonal Antibodies to Cytokines and Growth Factors
products references :
Zucht, H.D., et al., (1998), "Human beta-defensin-1: A urinary peptide present in variant molecular forms and its putative functional implication", Eur. J. Med. Res., 3:315-323.
ncbi gi num :
51574068
uniprot acc num :
P60022
ncbi mol weight :
7,420 Da
ncbi pathways :
Beta Defensins Pathway (530759); Defensins Pathway (530757); Immune System Pathway (106386); Innate Immune System Pathway (106387)
ncbi summary :
Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 1, an antimicrobial peptide implicated in the resistance of epithelial surfaces to microbial colonization. This gene maps in close proximity to defensin family member, defensin, alpha 1 and has been implicated in the pathogenesis of cystic fibrosis. [provided by RefSeq, Jul 2008]
uniprot summary :
Function: Has bactericidal activity. Subcellular location: Secreted. Tissue specificity: Plasma. Sequence similarities: Belongs to the beta-defensin family. Mass spectrometry: Molecular mass is 3928 0.5 Da from positions 33 - 68. Determined by ESI. Ref.5
size1 :
0.01 mg
price1 :
260 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!