product summary
Loading...
company name :
MyBioSource
product type :
antibody
product name :
MAb to beta-Defensin-2 (a.a. 4-41)
catalog :
MBS311949
quantity :
1 mg
price :
490 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
L12-4C-C2
reactivity :
mouse
application :
ELISA, enzyme immunoassay
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS311949
products type :
Antibody
products full name :
MAb to beta-Defensin-2 (a.a. 4-41)
products short name :
Defensin, beta-2 (a.a. 4-41)
products name syn :
Monoclonal Antibody to Human beta-Defensin-2 (amino acids 4-41)
other names :
Defensin beta 2; Beta-defensin 2; beta-defensin 2; OTTMUSP00000022725; defensin beta 2; Defensin, beta 2
other gene names :
Defb2; Defb2; BD-2; MGC129140; MGC129141
uniprot entry name :
DEFB2_MOUSE
clonality :
Monoclonal
isotype :
IgG1
clone :
L12-4C-C2
host :
Host: Mouse. Source: Cell Culture Supernatant
reactivity :
Human
specificity :
Defensin, beta-2 (a.a. 4-41). Synthetic human beta-Defensin 2 (a.a. 4-41)
purity :
Protein G Chromatography
form :
Purified, Lyophilized. Reconstitute in 1ml double distilled water.
storage stability :
Store lyophilized product at 2 to 8 degree C. After reconstitution, store at -20 degree C. Avoid multiple freeze/thaw cycles.
tested application :
EIA/ELISA
app notes :
Each laboratory should determine an optimum working titer for use in its particular application. Other applications have not been tested but use in such assays should not necessarily be excluded.
other info1 :
Immunogen: Synthetic human beta-Defensin 2 (a.a. 4-41)(DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP). Affinity Constant: Not determined.
other info2 :
Buffer: Lyophilized from 50mM Tris, pH 7.4. Preservative: No. Lyophilized: Yes. Important Note: Vial Contains Small Quantity. Centrifuge Product Before Opening!
products categories :
Monoclonal Antibodies to Cytokines and Growth Factors
ncbi gi num :
80478968
uniprot acc num :
P82020
ncbi mol weight :
7,820 Da
uniprot summary :
Function: Has bactericidal activity. Subcellular location: Secreted. Tissue specificity: Kidney, uterus and to a lesser extent in heart. Ref.1. Induction: In tracheal epithelium, by lipopolysaccharide or inflammation. Ref.1. Sequence similarities: Belongs to the beta-defensin family.
size1 :
1 mg
price1 :
490 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!