catalog number :
MBS2889590
products type :
Recombinant Protein
products full name :
Neurogranin
products short name :
[Neurogranin]
products name syn :
[RC3]
other names :
[neurogranin; Neurogranin; neurogranin; neurogranin; RC3]
products gene name :
[NRGN]
other gene names :
[NRGN; NRGN; RC3; hng; Ng]
sequence positions :
[1-78]
sequence :
MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRG
HMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGD
form :
Liquid; 50mM NaH2PO4, 500mM NaCl Buffer with 500mM Imidazole, 10% glycerol (pH8.0).
storage stability :
Store at -20 degree C for 6 months. Avoid repeated freezing and thawing.
tested application :
ELISA (EIA), Western Blot (WB), Affinity Purification (AP)
image1 heading :
SDS-PAGE
other info1 :
Organism: Homo sapiens (human)
products description :
Recombinant protein with His-tag
ncbi acc num :
NP_001119653.1
ncbi gb acc num :
NM_001126181.1
ncbi summary :
Neurogranin (NRGN) is the human homolog of the neuron-specific rat RC3/neurogranin gene. This gene encodes a postsynaptic protein kinase substrate that binds calmodulin in the absence of calcium. The NRGN gene contains four exons and three introns. The exons 1 and 2 encode the protein and exons 3 and 4 contain untranslated sequences. It is suggested that the NRGN is a direct target for thyroid hormone in human brain, and that control of expression of this gene could underlay many of the consequences of hypothyroidism on mental states during development as well as in adult subjects. [provided by RefSeq, Jul 2008]
uniprot summary :
Acts as a "third messenger" substrate of protein kinase C-mediated molecular cascades during synaptic development and remodeling. Binds to calmodulin in the absence of calcium ().