protein

Apoptosis-associated speck-like protein containing a CARD

MBS2889532

0.05 mg

405 USD

Protein

Apoptosis-associated speck-like protein containing a CARD

[Apoptosis-associated speck-like protein containing a CARD]

[ASC; CARD5; TMS1; Caspase recruitment domain-containing protein 5; PYD and CARD domain-containing protein; Target of methylation-induced silencing 1]

[apoptosis-associated speck-like protein containing a CARD isoform a; Apoptosis-associated speck-like protein containing a CARD; apoptosis-associated speck-like protein containing a CARD; PYD and CARD domain containing; Caspase recruitment domain-containing protein 5; PYD and CARD domain-containing protein; Target of methylation-induced silencing 1]

[PYCARD]

[PYCARD; PYCARD; ASC; TMS; TMS1; CARD5; TMS-1; ASC; CARD5; TMS1; hASC]

E Coli

[1-195aa]

195

MGRARDAILDALENLTAEELKKFKLKLLSVPLREGYGRI
PRGALLSMDALDLTDKLVSFYLETYGAELTANVLRDMGL
QEMAGQLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQ
HRAALIARVTNVEWLLDALYYGKVLTDEQYQAVRAEPTN
PSKMRKLFSFTPAWNWTTCKDLLLQALRESQSYLVEDLE
RS

>90%

Liquid

1 mg/mL

Store at -20°C for 6 months. Avoid repeated freezing and thawing.

ELISA (EIA), Western Blot (WB), Affinity Purification (AP)

Testing Data(TD)

Organism: Homo sapiens(human)

Buffer: 50mM NaH 2 PO 4 , 500mM NaCl Buffer with 500mM Imidazole, 10%glycerol(PH8.0)

Recombinant protein with His-tag.

10835256

NP_037390.2

NM_013258.4

Q9ULZ3

21.45 kD

Cytosolic DNA-sensing Pathway (125137); Cytosolic DNA-sensing Pathway (124833); Direct P53 Effectors Pathway (137939); Immune System Pathway (106386); Inflammasomes Pathway (366166); Influenza A Pathway (217173); Influenza A Pathway (217150); Innate Immune System Pathway (106387); Legionellosis Pathway (469200); Legionellosis Pathway (469186)

This gene encodes an adaptor protein that is composed of two protein-protein interaction domains: a N-terminal PYRIN-PAAD-DAPIN domain (PYD) and a C-terminal caspase-recruitment domain (CARD). The PYD and CARD domains are members of the six-helix bundle death domain-fold superfamily that mediates assembly of large signaling complexes in the inflammatory and apoptotic signaling pathways via the activation of caspase. In normal cells, this protein is localized to the cytoplasm; however, in cells undergoing apoptosis, it forms ball-like aggregates near the nuclear periphery. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Functions as key mediator in apoptosis and inflammation. Promotes caspase-mediated apoptosis involving predominantly caspase-8 and also caspase-9 in a probable cell type-specific manner. Involved in activation of the mitochondrial apoptotic pathway, promotes caspase-8-dependent proteolytic maturation of BID independently of FADD in certain cell types and also mediates mitochondrial translocation of BAX and activates BAX-dependent apoptosis coupled to activation of caspase-9, -2 and -3. Involved in macrophage pyroptosis, a caspase-1-dependent inflammatory form of cell death and is the major constituent of the ASC pyroptosome which forms upon potassium depletion and rapidly recruits and activates caspase-1. In innate immune response believed to act as an integral adapter in the assembly of the inflammasome which activates caspase-1 leading to processing and secretion of proinflammatory cytokines. The function as activating adapter in different types of inflammasomes is mediated by the pyrin and CARD domains and their homotypic interactions. Required for recruitment of caspase-1 to inflammasomes containing certain pattern recognition receptors, such as NLRP2, NLRP3, AIM2 and probably IFI16. In the NLRP1 and NLRC4 inflammasomes seems not be required but facilitates the processing of procaspase-1. In cooperation with NOD2 involved in an inflammasome activated by bacterial muramyl dipeptide leading to caspase-1 activation. May be involved in DDX58-triggered proinflammatory responses and inflammasome activation. Isoform 2 may have a regulating effect on the function as inflammasome adapter. Isoform 3 seems to inhibit inflammasome-mediated maturation of interleukin-1 beta. In collaboration with AIM2 which detects cytosolic double-stranded DNA may also be involved in a caspase-1-independent cell death that involves caspase-8. In adaptive immunity may be involved in maturation of dendritic cells to stimulate T-cell immunity and in cytoskeletal rearrangements coupled to chemotaxis and antigen uptake may be involved in post-transcriptional regulation of the guanine nucleotide exchange factor DOCK2; the latter function is proposed to involve the nuclear form. Also involved in transcriptional activation of cytokines and chemokines independent of the inflammasome; this function may involve AP-1, NF-kappa-B, MAPK and caspase-8 signaling pathways. For regulation of NF-kappa-B activating and inhibiting functions have been reported. Modulates NF-kappa-B induction at the level of the IKK complex by inhibiting kinase activity of CHUK and IKBK. Proposed to compete with RIPK2 for association with CASP1 thereby down-regulating CASP1-mediated RIPK2-dependent NF-kappa-B activation and activating interleukin-1 beta processing. Modulates host resistance to DNA virus infection, probably by inducing the cleavage of and inactivating CGAS in presence of cytoplasmic double-stranded DNA (PubMed:28314590).

0.05 mg

405 USD

0.1 mg

570

0.2 mg

845

0.5 mg

1225

1 mg

1665

5 mg

2860

10 mg

3790