product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Proliferation marker protein Ki-67
catalog :
MBS2889438
quantity :
0.05 mg
price :
405 USD
more info or order :
MyBioSource product webpage
image
image 1 :
MyBioSource MBS2889438 image 1
product information
catalog number :
MBS2889438
products type :
Protein
products full name :
Proliferation marker protein Ki-67
products short name :
[Proliferation marker protein Ki-67]
products name syn :
[Antigen identified by monoclonal antibody Ki-67; Antigen KI-67]
other names :
[proliferation marker protein Ki-67 isoform 2; Proliferation marker protein Ki-67; proliferation marker protein Ki-67; marker of proliferation Ki-67; Antigen identified by monoclonal antibody Ki-67]
products gene name :
[MKI67]
other gene names :
[MKI67; MKI67; KIA; MIB-; MIB-1; PPP1R105; Antigen KI-67Curated; Antigen Ki67Curated]
host :
E Coli
sequence positions :
[1122-1234aa]
sequence length :
2896
sequence :
EKTTKIACKSPPPESVDTPTSTKQWPKRSLRKADVEEEF
LALRKLTPSAGKAMLTPKPAGGDEKDIKAFMGTPVQKLD
LAGTLPGSKRQLQTPKEKAQALEDLAGFKELFQTP
purity :
>95%
form :
Liquid
concentration :
1 mg/mL
storage stability :
Store at -20°C for 6 months. (Avoid repeated freezing and thawing).
tested application :
ELISA (EIA), Western Blot (WB), Affinity Purification (AP)
image1 heading :
SDS-PAGE
other info1 :
Organism Species: Homo sapiens(human). Buffer: 50mM NaH 2 PO 4 , 500mM NaCl Buffer with 500mM Imidazole,10% glycerol(PH8).0).
products description :
Recombinant protein with His-tag
ncbi gi num :
225543215
ncbi acc num :
NP_001139438.1
ncbi gb acc num :
NM_001145966.1
uniprot acc num :
P46013
ncbi mol weight :
12.43 kD
ncbi summary :
This gene encodes a nuclear protein that is associated with and may be necessary for cellular proliferation. Alternatively spliced transcript variants have been described. A related pseudogene exists on chromosome X. [provided by RefSeq, Mar 2009]
uniprot summary :
Required to maintain individual mitotic chromosomes dispersed in the cytoplasm following nuclear envelope disassembly (PubMed:27362226). Associates with the surface of the mitotic chromosome, the perichromosomal layer, and covers a substantial fraction of the chromosome surface (PubMed:27362226). Prevents chromosomes from collapsing into a single chromatin mass by forming a steric and electrostatic charge barrier: the protein has a high net electrical charge and acts as a surfactant, dispersing chromosomes and enabling independent chromosome motility (PubMed:27362226). Binds DNA, with a preference for supercoiled DNA and AT-rich DNA (PubMed:10878551). Does not contribute to the internal structure of mitotic chromosomes (). May play a role in chromatin organization (PubMed:24867636). It is however unclear whether it plays a direct role in chromatin organization or whether it is an indirect consequence of its function in maintaining mitotic chromosomes dispersed (Probable).
size1 :
0.05 mg
price1 :
405 USD
size2 :
0.1 mg
price2 :
570
size3 :
0.2 mg
price3 :
845
size4 :
0.5 mg
price4 :
1225
size5 :
1 mg
price5 :
1665
size6 :
5 mg
price6 :
2860
size7 :
10 mg
price7 :
3790
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!