catalog number :
MBS2889276
products type :
Recombinant Protein
products full name :
Zinc finger protein GLI1
products short name :
[Zinc finger protein GLI1]
products name syn :
[GLI; Glioma-associated oncogene; Oncogene GLI]
other names :
[zinc finger protein GLI1 isoform 2; Zinc finger protein GLI1; zinc finger protein GLI1; GLI family zinc finger 1; Glioma-associated oncogene; Oncogene GLI]
products gene name :
[GLI1]
other gene names :
[GLI1; GLI1; GLI; GLI]
sequence positions :
[222-400aa]
sequence :
EREEKREPESVYETDCRWDGCSQEFDDSQEQLVHHINSE
HIHGERKEFVCHWGGCSRELRPFKAQYMLVVHMRRHTGE
KPHKCTFEGCRKSSYSRLENLKTHLRSHTGEKPYMCEHE
GCKSAFSNASDRAKHQNRTHSNEKPYVCKLPGCTKRYTD
PSSLRKHVKTVHGPDAHVKTRHRGD
storage stability :
Store at -20°C for 6 months. Avoid repeated freezing and thawing.
tested application :
Affinity Purification (AP), ELISA (EIA), Western Blot (WB)
image1 heading :
Testing Data (TD)
other info1 :
Organism Species: Homo sapiens (Human)
other info2 :
Storage Buffer: 50mM NaH2PO4, 500mM NaCl Buffer with 500mM Imidazole,10%glycerol(PH8.0)
products description :
Recombinant protein with His-tag (partial).
ncbi acc num :
NP_001153517.1
ncbi gb acc num :
NM_001160045.1
ncbi mol weight :
19.69 KD
ncbi pathways :
Basal Cell Carcinoma Pathway (83113); Basal Cell Carcinoma Pathway (525); Hedgehog Signaling Pathway (198835); Hedgehog Signaling Events Mediated By Gli Proteins Pathway (137912); Hedgehog Signaling Pathway (83063); Hedgehog Signaling Pathway (474); Pathways In Cancer (83105)
ncbi summary :
This gene encodes a member of the Kruppel family of zinc finger proteins. The encoded transcription factor is activated by the sonic hedgehog signal transduction cascade and regulates stem cell proliferation. The activity and nuclear localization of this protein is negatively regulated by p53 in an inhibitory loop. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2009]
uniprot summary :
Acts as a transcriptional activator (PubMed:19706761, PubMed:10806483, PubMed:19878745, PubMed:24311597, PubMed:24217340). Binds to the DNA consensus sequence 5'-GACCACCCA-3' (PubMed:2105456, PubMed:8378770, PubMed:24217340). May regulate the transcription of specific genes during normal development (PubMed:19706761). May play a role in craniofacial development and digital development, as well as development of the central nervous system and gastrointestinal tract. Mediates SHH signaling (PubMed:19706761). Plays a role in cell proliferation and differentiation via its role in SHH signaling (Probable).