product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Wilms tumor protein homolog
catalog :
MBS2888998
quantity :
0.05 mg
price :
405 USD
more info or order :
MyBioSource product webpage
image
image 1 :
MyBioSource MBS2888998 image 1
12% SDS-PAGE
product information
catalog number :
MBS2888998
products type :
Recombinant Protein
products full name :
Wilms tumor protein homolog
products short name :
[Wilms tumor protein homolog]
products name syn :
[Wt-1]
other names :
[Wilms tumor protein homolog; Wilms tumor protein homolog; Wilms tumor protein homolog; Wilms tumor 1 homolog]
products gene name :
[WT1]
other gene names :
[Wt1; Wt1; Wt-1; D630046I19Rik; Wt-1]
host :
E. coli
sequence :
TEGQSNHGIGYESENHTAPILCGAQYRIHTHGVFRGIQD
VRRVSGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLS
HLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRH
TGVKPFQCKTCQRKFSRSDHLKTHTRTHTGKTSEKPFSC
RWHSCQKKFARSDELVRHHNMHQRNMTKLHVAL
purity :
>90%
form :
50mM NaH 2 PO 4 , 500mM NaCl Buffer with 500mM Imidazole, 10% glycerol (PH 8.0)
concentration :
1mg/ml
storage stability :
Store at -20°C for 6 months. Avoid repeated freezing and thawing.
tested application :
Affinity Purification (AP), ELISA, Western Blot (WB)
image1 heading :
SDS-PAGE
other info1 :
Organism: Mus musculus (Mouse). Protein Accession: P22561 (261-449aa)
products description :
Recombinant protein with His-tag
ncbi gi num :
139779
ncbi acc num :
P22561.1
uniprot acc num :
P22561
ncbi mol weight :
20.79KD
ncbi pathways :
Transcriptional Misregulation In Cancer Pathway (523020); Transcriptional Misregulation In Cancer Pathway (522987)
ncbi summary :
This gene encodes a transcription factor that contains four zinc-finger motifs at the C-terminus and a proline/glutamine-rich DNA-binding domain at the N-terminus. It plays an essential role in the normal development of the urogenital system, and the orthologous human gene is mutated in a small subset of patients with Wilm's tumors. Alternative splicing has been noted for this gene, however, the full-length nature of these variants is not known. The mRNA for this gene has been shown to initiate translation from non-AUG (CUG) and AUG translation start sites, resulting in different isoforms. [provided by RefSeq, Apr 2013]
uniprot summary :
Transcription factor that plays an important role in cellular development and cell survival (PubMed:16467207, PubMed:16920711, PubMed:17537799). Recognizes and binds to the DNA sequence 5'-GCG(T/G)GGGCG-3' (). Regulates the expression of numerous target genes, including EPO (PubMed:16467207). Plays an essential role for development of the urogenital system. It has a tumor suppressor as well as an oncogenic role in tumor formation. Function may be isoform-specific: isoforms lacking the KTS motif may act as transcription factors. Isoforms containing the KTS motif may bind mRNA and play a role in mRNA metabolism or splicing (PubMed:17167543). Isoform 1 has lower affinity for DNA, and can bind RNA.
size1 :
0.05 mg
price1 :
405 USD
size2 :
0.1 mg
price2 :
570
size3 :
0.2 mg
price3 :
845
size4 :
0.5 mg
price4 :
1225
size5 :
1 mg
price5 :
1665
size6 :
5 mg
price6 :
2860
size7 :
10 mg
price7 :
3790
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!