catalog number :
MBS2888658
products full name :
Interleukin-23 subunit alpha
products short name :
[Interleukin-23 subunit alpha]
products name syn :
[UNQ2498/PRO5798; SGRF; Interleukin-23 subunit p19; IL-23p19]
other names :
[interleukin-23 subunit alpha; Interleukin-23 subunit alpha; interleukin-23 subunit alpha; interleukin 23 subunit alpha; Interleukin-23 subunit p19; IL-23p19]
products gene name :
[IL23A]
other gene names :
[IL23A; IL23A; P19; SGRF; IL-23; IL-23A; IL23P19; SGRF; IL-23 subunit alpha; IL-23-A; IL-23p19]
sequence :
EEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQG
LIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLL
QPEGHHW
form :
50mM NaH 2 PO 4 , 500mM NaCl Buffer with 500mM Imidazole, 10%glycerol (PH8.0)
concentration :
1 mg/mL ; 0.05mg
storage stability :
Store at -20°C. (Avoid repeated freezing and thawing.)
tested application :
ELISA (EIA), Western Blot (WB), Affinity Purification (AP)
image1 heading :
SDS-PAGE
other info1 :
Organism: Homo sapiens (human). Protein Accession: Q9NPF7 (58-142aa)
products categories :
Immunology
products description :
Recombinant protein with His-tag
ncbi acc num :
NP_057668.1
ncbi gb acc num :
NM_016584.2
ncbi pathways :
ATF-2 Transcription Factor Network Pathway (138006); Cytokine-cytokine Receptor Interaction Pathway (83051); Cytokine-cytokine Receptor Interaction Pathway (460); IL23-mediated Signaling Events Pathway (138000); Inflammatory Bowel Disease (IBD) Pathway (842771); Inflammatory Bowel Disease (IBD) Pathway (842797); Jak-STAT Signaling Pathway (83077); Jak-STAT Signaling Pathway (488); Pertussis Pathway (218111); Pertussis Pathway (218099)
ncbi summary :
This gene encodes a subunit of the heterodimeric cytokine interleukin 23 (IL23). IL23 is composed of this protein and the p40 subunit of interleukin 12 (IL12B). The receptor of IL23 is formed by the beta 1 subunit of IL12 (IL12RB1) and an IL23 specific subunit, IL23R. Both IL23 and IL12 can activate the transcription activator STAT4, and stimulate the production of interferon-gamma (IFNG). In contrast to IL12, which acts mainly on naive CD4(+) T cells, IL23 preferentially acts on memory CD4(+) T cells. [provided by RefSeq, Jul 2008]
uniprot summary :
Associates with IL12B to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.