protein

Recombinant Human Caveolin-1 (CAV1) Protein

MBS286537

0.1 mg

405 USD

Recombinant Protein

Recombinant Human Caveolin-1 (CAV1) Protein

[Caveolin-1 (CAV1)]

[VIP21; Caveolae Protein 22kDa.]

[caveolin 1, partial; Caveolin-1; caveolin-1; caveolin 1]

[CAV1]

[CAV1; CAV1; CGL3; PPH3; BSCL3; LCCNS; VIP21; MSTP085; CAV]

E.coli 11-179 AA (Q03135).

Human

[11-179]

GHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEI
DLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKAS
FTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHI
WAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKI
FSNVRINLQKEI

> 90 % as determined by SDS-PAGE.

PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 5% trehalose, pH 7.4) added with 300 mM Imidazole and 15% glycerol.

0.8 mg/mL

Storage:. Store it under sterile conditions at -20°C upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage. **Avoid repeated freeze-thaw cycles.**. Stability:. The recombinant protein is stable for up to 12 months from date of receipt at -80°C.

SDS-PAGE

Source: Human. Protein Residues: with N-terminal 6* His-tag.

Usage: CAV1 Protein - Centrifuge the standard vial at 6000-10000rpm for 30s. Endotoxin Level: Please contact us for more information.

The scaffolding protein encoded by this gene is the main component of the caveolae plasma membranes found in most cell types. The protein links integrin subunits to the tyrosine kinase FYN, an initiating step in coupling integrins to the Ras-ERK pathway and promoting cell cycle progression. The gene is a tumor suppressor gene candidate and a negative regulator of the Ras-p42/44 MAP kinase cascade. CAV1 and CAV2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. By using alternative initiation codons in the same reading frame, two isoforms (alpha and beta) are encoded by a single transcript from this gene.

4972627

AAD34722.1

Q03135

Predicted MW: 27 kDa. Observed MW: 27 kDa

ALK1 Signaling Events Pathway (137968); Androgen Receptor Signaling Pathway (198806); Bacterial Invasion Of Epithelial Cells Pathway (149807); Bacterial Invasion Of Epithelial Cells Pathway (148661); Basigin Interactions Pathway (106065); Canonical Wnt Signaling Pathway (138032); Cell Surface Interactions At The Vascular Wall Pathway (106062); Direct P53 Effectors Pathway (137939); Disease Pathway (530764); EGFR1 Signaling Pathway (198782)

The scaffolding protein encoded by this gene is the main component of the caveolae plasma membranes found in most cell types. The protein links integrin subunits to the tyrosine kinase FYN, an initiating step in coupling integrins to the Ras-ERK pathway and promoting cell cycle progression. The gene is a tumor suppressor gene candidate and a negative regulator of the Ras-p42/44 mitogen-activated kinase cascade. Caveolin 1 and caveolin 2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. Mutations in this gene have been associated with Berardinelli-Seip congenital lipodystrophy. Alternatively spliced transcripts encode alpha and beta isoforms of caveolin 1.[provided by RefSeq, Mar 2010]

Caveolin-1: May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Involved in the costimulatory signal essential for T-cell receptor (TCR)- mediated T-cell activation. Its binding to DPP4 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3- dependent manner. Recruits CTNNB1 to caveolar membranes and may regulate CTNNB1-mediated signaling through the Wnt pathway. Homooligomer. Interacts with GLIPR2, NOSTRIN, SNAP25 and syntaxin. Interacts with rotavirus A NSP4. Interacts (via the N- terminus) with DPP4; the interaction is direct. Interacts with CTNNB1, CDH1 and JUP. Interacts with BMX and BTK. Expressed in muscle and lung, less so in liver, brain and kidney. Belongs to the caveolin family. 2 isoforms of the human protein are produced by alternative initiation. Protein type: Adaptor/scaffold; Motility/polarity/chemotaxis; Nuclear receptor co-regulator. Chromosomal Location of Human Ortholog: 7q31.2. Cellular Component: caveola; cytoplasmic vesicle; early endosome membrane; endoplasmic reticulum; endoplasmic reticulum membrane; endosome; focal adhesion; Golgi membrane; intracellular; lipid particle; lipid raft; membrane; perinuclear region of cytoplasm; plasma membrane; protein complex. Molecular Function: ATPase binding; cholesterol binding; enzyme binding; identical protein binding; nitric-oxide synthase binding; protease activator activity; protein binding; protein complex scaffold; protein kinase binding; Rac GTPase binding; receptor binding; structural molecule activity. Biological Process: calcium ion homeostasis; calcium ion transport; cellular calcium ion homeostasis; cholesterol homeostasis; cholesterol transport; cytosolic calcium ion homeostasis; inactivation of MAPK activity; leukocyte migration; maintenance of cellular protein localization; mammary gland development; mammary gland involution; membrane depolarization; negative regulation of endothelial cell proliferation; negative regulation of epithelial cell differentiation; negative regulation of JAK-STAT cascade; negative regulation of MAPKKK cascade; negative regulation of nitric oxide biosynthetic process; negative regulation of peptidyl-serine phosphorylation; negative regulation of pinocytosis; negative regulation of protein binding; negative regulation of protein ubiquitination; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transforming growth factor beta receptor signaling pathway; nitric oxide homeostasis; positive regulation of catalytic activity; positive regulation of peptidyl-serine phosphorylation; positive regulation of protein binding; positive regulation of protein ubiquitination; positive regulation of toll-like receptor 3 signaling pathway; positive regulation of vasoconstriction; protein homooligomerization; protein localization; receptor internalization; receptor mediated endocytosis of virus by host; regulation of blood coagulation; regulation of fatty acid metabolic process; regulation of nitric-oxide synthase activity; regulation of peptidase activity; regulation of smooth muscle contraction; response to bacterium; response to calcium ion; response to estrogen stimulus; response to hypoxia; response to progesterone stimulus; sequestering of lipid; skeletal muscle development; T cell costimulation; triacylglycerol metabolic process; vasculogenesis; vesicle organization and biogenesis. Disease: Lipodystrophy, Congenital Generalized, Type 3; Partial Lipodystrophy, Congenital Cataracts, And Neurodegeneration Syndrome; Pulmonary Hypertension, Primary, 3

0.1 mg

405 USD

0.5 mg

1155

1 mg

1605