Recombinant Human Ubiquitin-like modifieractivating enzyme ATG7 (ATG7) Protein | MyBioSource MBS286531 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Ubiquitin-like modifieractivating enzyme ATG7 (ATG7) Protein

catalog :

MBS286531

quantity :

0.1 mg

price :

405 USD

more info or order :

MyBioSource product webpage

image

image 1 :

product information

catalog number :

MBS286531

products type :

Recombinant Protein

products full name :

Recombinant Human Ubiquitin-like modifieractivating enzyme ATG7 (ATG7) Protein

products short name :

[Ubiquitin-like modifier-activating enzyme ATG7 (ATG7)]

products name syn :

[APG7L; GSA7; ATG12-activating enzyme E1 ATG7; Ubiquitin-activating enzyme E1-like protein.]

other names :

[ubiquitin-like modifier-activating enzyme ATG7 isoform c; Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like modifier-activating enzyme ATG7; autophagy related 7; ATG12-activating enzyme E1 ATG7; Autophagy-related protein 7; APG7-like; hAGP7; Ubiquitin-activating enzyme E1-like protein]

products gene name :

[ATG7]

other gene names :

[ATG7; ATG7; GSA7; APG7L; APG7-LIKE; APG7L; APG7-like; hAGP7]

host :

E. coli

reactivity :

Human

sequence positions :

[293-563]

sequence :

AFSPDCPKAVGWEKNQKGGMGPRMVNLSECMDPKRLAES
SVDLNLKLMCWRLVPTLDLDKVVSVKCLLLGAGTLGCNV
ARTLMGWGVRHITFVDNAKISYSNPVRQPLYEFEDCLGG
GKPKALAAADRLQKIFPGVNARGFNMSIPMPGHPVNFSS
VTLEQARRDVEQLEQLIESHDVVFLLMDTRESRWLPAVI
AASKRKLVINAALGFDTFVVMRHGLKKPKQQGAGDLCPN
HPVASADLLGSSLFANIPGYKLGCYFC3NDVVAPGDST

purity :

> 90 % as determined by SDS-PAGE.

form :

PBS (58 mM Na 2 HPO 4 , 17 mM NaH 2 PO 4 , 68 mM NaCl, 5% trehalose, pH 7.4) added with 300 mM Imidazole and 15% glycerol.

concentration :

0.4 mg/mL

storage stability :

Storage: Store it under sterile conditions at -20°C upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage. **Avoid repeated freeze-thaw cycles.**. Stability: The recombinant protein is stable for up to 12 months from date of receipt at -80°C.

image1 heading :

SDS-PAGE

other info1 :

Species: Human. Source: Human. Endotoxin level: Please contact us for more information.

other info2 :

Protein Residues: with N-terminal 6* His-tag. Usage: ATG7 Protein - Centrifuge the standard vial at 6000-10000rpm for 30s.

products description :

ATG7 was identified based on homology to Pichia pastoris GSA7 and Saccharomyces cerevisiae APG7. In the yeast, the protein appears to be required for fusion of peroxisomal and vaculuolar membranes. The protein shows homology to the ATP-binding and catalytic sites of the E1 ubiquitin activating enzymes. The deduced 703-amino acid protein contains a central putative E1-like ATP-binding site (GxGxxG), conserved charged amino acids flanking the GxGxxG motif, and a putative E1 active site with a conserved catalytic cysteine. APG7L shares similarity with the E1 enzymes UBA2 and UBA3 (UBE1C), and it shares 38% identity with yeast Apg7. EST database analysis indicated that APG7L is expressed by many diverse tissues.

ncbi gi num :

222144229

ncbi acc num :

NP_001138384.1

ncbi gb acc num :

NM_001144912.1

uniprot acc num :

O95352

ncbi mol weight :

Predicted MW: 36 kDa. Observed MW: 36 kDa

ncbi pathways :

Adaptive Immune System Pathway (366160); Antigen Processing: Ubiquitination Proteasome Degradation Pathway (366162); Class I MHC Mediated Antigen Processing Presentation Pathway (366161); Immune System Pathway (106386); Regulation Of Autophagy Pathway (83058); Regulation Of Autophagy Pathway (468); Senescence And Autophagy Pathway (198780)

ncbi summary :

This gene encodes an E1-like activating enzyme that is essential for autophagy and cytoplasmic to vacuole transport. The encoded protein is also thought to modulate p53-dependent cell cycle pathways during prolonged metabolic stress. It has been associated with multiple functions, including axon membrane trafficking, axonal homeostasis, mitophagy, adipose differentiation, and hematopoietic stem cell maintenance. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015]

uniprot summary :

E1-like activating enzyme involved in the 2 ubiquitin-like systems required for cytoplasm to vacuole transport (Cvt) and autophagy. Activates ATG12 for its conjugation with ATG5 as well as the ATG8 family proteins for their conjugation with phosphatidylethanolamine. Both systems are needed for the ATG8 association to Cvt vesicles and autophagosomes membranes. Required for autophagic death induced by caspase-8 inhibition. Required for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Modulates p53/TP53 activity to regulate cell cycle and survival during metabolic stress. Plays also a key role in the maintenance of axonal homeostasis, the prevention of axonal degeneration, the maintenance of hematopoietic stem cells, the formation of Paneth cell granules, as well as in adipose differentiation.

size1 :

0.1 mg

price1 :

405 USD

size2 :

0.5 mg

price2 :

1155

size3 :

1 mg

price3 :

1605

more info or order :

MyBioSource product webpage