protein

Recombinant Human Membrane cofactor protein (CD46) Protein

MBS286516

0.1 mg

370 USD

Recombinant Protein

Recombinant Human Membrane cofactor protein (CD46) Protein

[Membrane cofactor protein (CD46)]

[MCP; MIC10; TLX; TRA2; Trophoblast leukocyte common antigen; CD46 Molecule, Complement Regulatory Protein; CD46 Molecule,Complement Regulatory protein]

[membrane cofactor protein; Membrane cofactor protein; membrane cofactor protein; CD46 molecule; TLX; Trophoblast leukocyte common antigen; CD_antigen: CD46]

[CD46]

[CD46; CD46; MCP; TLX; AHUS2; MIC10; TRA2.10; MCP; MIC10]

E. coli Ser32-Lys333 (P15529).

Human

369

SDACEEPPTFEAMELIGKPKPYYEIGERVDYKCKKGYFY
IPPLATHTICDRNHTWLPVSDDACYRETCPYIRDPLNGQ
AVPANGTYEFGYQMHFICNEGYYLIGEEILYCELKGSVA
IWSGKPPICEKVLCTPPPKIKNGKHTFSEVEVFEYLDAV
TYSCDPAPGPDPFSLIGESTIYCGDNSVWSRAAPECKVV
KCRFPVVENGKQISGFGKKFYYKATVMFECDKGFYLDGS
DTIVCDSNSTWDPPVPKCLKVLPPSSTKPPALSHSVSTS
STTKSPASSASGPRPTYKPPVSNYPGYPK

> 90 % as determined by SDS-PAGE.

In 0.15M PBS, pH 7.4-7.5, with 8M urea and 50% glycerol.

0.5 mg/mL

Store it under sterile conditions at -20°C to -80°C upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage. **Avoid repeated freeze-thaw cycles.**. Stability: The recombinant protein is stable for up to 12 months from date of receipt at -80°C.

SDS-PAGE

Source: Human

Protein Residues: with N-terminal His-tag. Predicted MW: 34 kDa. Observed MW: 34 kDa. Usage: CD46 Protein - Centrifuge the standard vial at 6000-10000rpm for 30s.

262938

AAB24802.1

Complement And Coagulation Cascades Pathway (198880); Complement And Coagulation Cascades Pathway (83073); Complement And Coagulation Cascades Pathway (484); Complement Cascade Pathway (106405); Immune System Pathway (106386); Innate Immune System Pathway (106387); Measles Pathway (213306); Measles Pathway (213277); Regulation Of Complement Cascade Pathway (576254)

The protein encoded by this gene is a type I membrane protein and is a regulatory part of the complement system. The encoded protein has cofactor activity for inactivation of complement components C3b and C4b by serum factor I, which protects the host cell from damage by complement. In addition, the encoded protein can act as a receptor for the Edmonston strain of measles virus, human herpesvirus-6, and type IV pili of pathogenic Neisseria. Finally, the protein encoded by this gene may be involved in the fusion of the spermatozoa with the oocyte during fertilization. Mutations at this locus have been associated with susceptibility to hemolytic uremic syndrome. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jun 2010]

CD46: Acts as a cofactor for complement factor I, a serine protease which protects autologous cells against complement- mediated injury by cleaving C3b and C4b deposited on host tissue. May be involved in the fusion of the spermatozoa with the oocyte during fertilization. Also acts as a costimulatory factor for T- cells which induces the differentiation of CD4+ into T-regulatory 1 cells. T-regulatory 1 cells suppress immune responses by secreting interleukin-10, and therefore are thought to prevent autoimmunity. A number of viral and bacterial pathogens seem to exploit this property and directly induce an immunosuppressive phenotype in T-cells by binding to CD46. Defects in CD46 are a cause of susceptibility to hemolytic uremic syndrome atypical type 2 (AHUS2). An atypical form of hemolytic uremic syndrome. It is a complex genetic disease characterized by microangiopathic hemolytic anemia, thrombocytopenia, renal failure and absence of episodes of enterocolitis and diarrhea. In contrast to typical hemolytic uremic syndrome, atypical forms have a poorer prognosis, with higher death rates and frequent progression to end-stage renal disease. Susceptibility to the development of atypical hemolytic uremic syndrome can be conferred by mutations in various components of or regulatory factors in the complement cascade system. Other genes may play a role in modifying the phenotype. Patients with CD46 mutations seem to have an overall better prognosis compared to patients carrying CFH mutations. 16 isoforms of the human protein are produced by alternative splicing. Protein type: Cell surface; Membrane protein, integral; Receptor, misc. Chromosomal Location of Human Ortholog: 1q32.2. Cellular Component: cell surface; focal adhesion; integral to plasma membrane; plasma membrane. Molecular Function: cadherin binding; protein binding; receptor activity. Biological Process: adaptive immune response; interleukin-10 production; positive regulation of interleukin-10 production; positive regulation of memory T cell differentiation; positive regulation of regulatory T cell differentiation; positive regulation of T cell proliferation; regulation of complement activation; regulation of Notch signaling pathway; T cell mediated immunity. Disease: Hemolytic Uremic Syndrome, Atypical, Susceptibility To, 2

0.1 mg

370 USD

0.5 mg

1045

1 mg

1455