Recombinant Human MMP9 Protein | MyBioSource MBS286219 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human MMP9 Protein

catalog :

MBS286219

quantity :

0.1 mg

price :

370 USD

more info or order :

MyBioSource product webpage

image

image 1 :

SDS-PAGE

product information

catalog number :

MBS286219

products type :

Recombinant Protein

products full name :

Recombinant Human MMP9 Protein

products short name :

[MMP9]

products name syn :

[GELB; Gelatinase B; CLG4B; CLG4-B; 92 KDa Gelatinase; 92kDa Type IV Collagenase]

other names :

[matrix metalloproteinase-9 preproprotein; Matrix metalloproteinase-9; matrix metalloproteinase-9; matrix metallopeptidase 9; 92 kDa gelatinase; 92 kDa type IV collagenase; Gelatinase B; GELB]

products gene name :

[MMP9]

other gene names :

[MMP9; MMP9; GELB; CLG4B; MMP-9; MANDP2; CLG4B; MMP-9; GELB]

uniprot entry name :

MMP9_HUMAN

host :

E. coli AA 210-346 (P14780).

sequence length :

707

sequence :

YDTDDRFGFCPSERLYTRDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYR WCATTANYDRDKLFGFCPTRADSTVMGGNSAGEL
WSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDG
RSDGLPWCSTTAN

purity :

> 95% as determined by SDS-PAGE

form :

58 mM Na 2 HPO 4 , 17 mM NaH 2 PO 4 , 68 mM NaCl, 300 mM Imidazole, pH 8.0,with 15% glycerol.

concentration :

1 mg/mL

storage stability :

Store it under sterile conditions at -20°C upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage. Stability: The recombinant protein is stable for up to 6 months from date of receipt at -80°C.

tested application :

Western Blot (WB), ELISA (EIA), SDS-PAGE, Antigen

image1 heading :

Testing data TD

other info1 :

Source: Human. Species: Human. Protein Residues: with N-terminal 6×His-tag. Predicted Molecular Mass: Predicted MW: 21 kDa. Observed MW: 21 kDa. USAGE: MMP9 Protein-Centrifuge the standard vial at 6000-10000rpm for 30s.

products description :

MMP-9 (also known as gelatinase B) is secreted as a 92 kDa zymogen. Cleavage of pro-MMP-9 at or near residue 87 results in the active enzyme with a mass of approximately 82 kDa. MMP-9 has three fibronectin type II domains, a hemopexin-like domain and a proline-rich type V collagen-homologous domain. Pro-MMP-9 can be activated by MMP-3 or by certain bacterial proteinases. MMP-9 is inhibited by?2-macroglobulin or by TIMP-1, which binds to pro-MMP-9 as well as to active MMP-9.Pro-MMP-9 is secreted by monocytes, macrophages, neutrophils, keratinocytes, fibroblasts, osteoclasts, chondrocytes, skeletal muscle satellite cells, endothelial cells, and various tumor cells. Pro-MMP-9 expression is upregulated by TGF-?1, IL-1?, TGF-?, PDGF-AB.

ncbi gi num :

74272287

ncbi acc num :

NP_004985.2

ncbi gb acc num :

NM_004994.2

uniprot acc num :

P14780

ncbi mol weight :

21kDa

ncbi pathways :

AGE/RAGE Pathway (698754); Activation Of Matrix Metalloproteinases Pathway (1270258); Angiogenesis Pathway (198772); Assembly Of Collagen Fibrils And Other Multimeric Structures Pathway (1270247); Axon Guidance Pathway (1270303); Bladder Cancer Pathway (83115); Bladder Cancer Pathway (527); CXCR4-mediated Signaling Events Pathway (137910); Collagen Degradation Pathway (1270259); Collagen Formation Pathway (1270245)

ncbi summary :

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades type IV and V collagens. Studies in rhesus monkeys suggest that the enzyme is involved in IL-8-induced mobilization of hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling. [provided by RefSeq, Jul 2008]

uniprot summary :

MMP9: May play an essential role in local proteolysis of the extracellular matrix and in leukocyte migration. Could play a role in bone osteoclastic resorption. Cleaves KiSS1 at a Gly- -Leu bond. Cleaves type IV and type V collagen into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments. Degrades fibronectin but not laminin or Pz-peptide. Exists as monomer or homodimer; disulfide-linked. Exists also as heterodimer with a 25 kDa protein. Macrophages and transformed cell lines produce only the monomeric form. Interacts with ECM1. Activated by 4-aminophenylmercuric acetate and phorbol ester. Up-regulated by ARHGEF4, SPATA13 and APC via the JNK signaling pathway in colorectal tumor cells. Produced by normal alveolar macrophages and granulocytes. Inhibited by histatin-3 1/24 (histatin-5). Inhibited by ECM1. Belongs to the peptidase M10A family. Protein type: EC 3.4.24.35; Motility/polarity/chemotaxis; Protease; Secreted; Secreted, signal peptide. Chromosomal Location of Human Ortholog: 20q13.12. Cellular Component: extracellular region; extracellular space. Molecular Function: collagen binding; endopeptidase activity; identical protein binding; metalloendopeptidase activity; metallopeptidase activity; protein binding; serine-type endopeptidase activity; zinc ion binding. Biological Process: collagen catabolic process; ephrin receptor signaling pathway; extracellular matrix disassembly; macrophage differentiation; negative regulation of apoptosis; positive regulation of cell migration; positive regulation of DNA binding; positive regulation of epidermal growth factor receptor signaling pathway; positive regulation of keratinocyte migration; positive regulation of protein amino acid phosphorylation; proteolysis. Disease: Metaphyseal Anadysplasia 2

size1 :

0.1 mg

price1 :

370 USD

size2 :

0.5 mg

price2 :

1045

size3 :

1 mg

price3 :

1455

more info or order :

MyBioSource product webpage