protein

Recombinant Human APOM Protein

MBS286217

0.1 mg

370 USD

Recombinant Protein

Recombinant Human APOM Protein

[APOM]

[APOM; G3a; HSPC336; NG20; apo-M]

[apolipoprotein M isoform 2; Apolipoprotein M; apolipoprotein M; apolipoprotein M; Protein G3a]

[APOM]

[APOM; APOM; G3a; NG20; apo-M; HSPC336; G3A; NG20; Apo-M; ApoM]

APOM_HUMAN

E. coli AA 1-188 (O95445).

MFHQIWAALLYFYGIILNSIYQCPEHSQLTTLGVDGKEF
PEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSA
PMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRP
DMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEK
CVEEFKSLTSCLDSKAFLLTPRNQEACELSNN

> 90 % as determined by SDS-PAGE.

10 mM Tris-HCl, 1 mM EDTA, pH 8.0, 50% glycerol.

2.1 mg/mL

Store it under sterile conditions at -20°C upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage. The recombinant protein is stable for up to 6-12 months from date of receipt at -20°C to -80°C. **Avoid repeated freeze-thaw cycles.**

SDS-PAGE

Species: Human. Source: Human. Protein Residues: with N-terminal 10×His-GST-tagged. Endotoxin Level: Please contact us for more information.

Usage: APOM Protein - Centrifuge the standard vial at 6000-10000rpm for 30s.

Apolipoprotein M is an apolipoprotein and member of the lipocalin protein family. It is found associated with high density lipoproteins and to a lesser extent with low density lipoproteins and triglyceride-rich lipoproteins. The encoded protein is secreted through the plasma membrane but remains membrane-bound, where it is involved in lipid transport. Two transcript variants encoding two different isoforms have been found for this gene, but only one of them has been fully characterized. The deduced 188-amino acid protein has a calculated molecular mass of about 21 kD. It contains a potential N-glycosylation site, 2 possible disulfide bridges, and a hydrophobic alpha-helical signal peptide that is retained in the mature protein. Sequence analysis revealed 79% identity between the human and mouse proteins.

371873523

NP_001243098.1

NM_001256169.1

O95445

Predicted MW: 49.8 kDa. Observed MW: 50 kDa

Metabolism Pathway (1269956); Metabolism Of Fat-soluble Vitamins Pathway (1339147); Metabolism Of Vitamins And Cofactors Pathway (1270144); Retinoid Metabolism And Transport Pathway (1269624); Signal Transduction Pathway (1269379); Visual Phototransduction Pathway (1269623)

The protein encoded by this gene is an apolipoprotein and member of the lipocalin protein family. It is found associated with high density lipoproteins and to a lesser extent with low density lipoproteins and triglyceride-rich lipoproteins. The encoded protein is secreted through the plasma membrane but remains membrane-bound, where it is involved in lipid transport. Alternate splicing results in both coding and non-coding variants of this gene. [provided by RefSeq, Jan 2012]

APOM: Probably involved in lipid transport. Can bind sphingosine-1-phosphate, myristic acid, palmitic acid and stearic acid, retinol, all-trans-retinoic acid and 9-cis-retinoic acid. Plasma protein. Expressed in liver and kidney. Belongs to the calycin superfamily. Lipocalin family. Highly divergent. Protein type: Secreted; Secreted, signal peptide. Chromosomal Location of Human Ortholog: 6p21.33. Cellular Component: extracellular region; integral to plasma membrane. Molecular Function: antioxidant activity; lipid transporter activity; phospholipid binding. Biological Process: cholesterol efflux; cholesterol homeostasis; retinoid metabolic process; reverse cholesterol transport

0.1 mg

370 USD

0.5 mg

1045

1 mg

1455