protein

Recombinant Human GAPDH Protein

MBS286156

0.1 mg

370 USD

Recombinant Protein

Recombinant Human GAPDH Protein

[GAPDH]

[G3PD; GAPD; Peptidyl-cysteine S-nitrosylase GAPDH]

[glyceraldehyde-3-phosphate dehydrogenase isoform 2; Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde-3-phosphate dehydrogenase; Peptidyl-cysteine S-nitrosylase GAPDH (EC:2.6.99.-)]

[GAPDH]

[GAPDH; GAPDH; G3PD; GAPD; HEL-S-162eP; GAPD; GAPDH]

G3P_HUMAN

E.coli Full Length protein (P04406)

293

MGKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFID
LNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQ
ERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAK
RVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNC
LAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKL
WRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFR
VPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGI
LGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLIS
WYDNEFGYSNRVVDLMAHMASKE

> 90% as determined by SDS-PAGE

In PBS, pH 7.4, with 25% glycerol

1 mg/ml

Storage: Store it under sterile conditions at -20°C upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage. **Avoid repeated freeze-thaw cycles.**. Stability: The recombinant protein is stable for up to 12 months from date of receipt at -80°C.

Western Blot (WB), ELISA (EIA)

Usage: GAPDH Protein - Centrifuge the standard vial at 6000-10000rpm for 30s

SDS-PAGE

Source: Human. Protein Residues: with N-terminal His-tag

Glyceraldehyde 3-phosphate dehydrogenase is an enzyme that catalyzes the sixth step of glycolysis and thus serves to break down glucose for energy and carbon molecules. In addition to this long established metabolic function, GAPDH has recently been implicated in several non-metabolic processes, including transcription activation, initiation of apoptosis, and ER to Golgi vesicle shuttling. Glyceraldehyde 3-phosphate dehydrogenase (GAPDH) catalyses the conversion of glyceraldehyde 3-phosphate as the name indicates. This is the 6th step of the breakdown of glucose (glycolysis), an important pathway of energy and carbon molecule supply located in the cytosol of eukaryotic cells. Glyceraldehyde 3-phosphate is converted to D-glycerate 1,3-bisphosphate in two coupled steps.

378404908

NP_001243728.1

NM_001256799.2

P04406

Predicted MW: 35kDa. Observed MW: 37kDa

Alzheimer's Disease Pathway (83097); Alzheimer's Disease Pathway (509); Alzheimers Disease Pathway (672448); Biosynthesis Of Amino Acids Pathway (790012); Biosynthesis Of Amino Acids Pathway (795174); Carbon Metabolism Pathway (814926); Carbon Metabolism Pathway (817567); Cori Cycle Pathway (920985); Gluconeogenesis Pathway (1269961); Gluconeogenesis, Oxaloacetate = Fructose-6P Pathway (413342)

This gene encodes a member of the glyceraldehyde-3-phosphate dehydrogenase protein family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. The product of this gene catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The encoded protein has additionally been identified to have uracil DNA glycosylase activity in the nucleus. Also, this protein contains a peptide that has antimicrobial activity against E. coli, P. aeruginosa, and C. albicans. Studies of a similar protein in mouse have assigned a variety of additional functions including nitrosylation of nuclear proteins, the regulation of mRNA stability, and acting as a transferrin receptor on the cell surface of macrophage. Many pseudogenes similar to this locus are present in the human genome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2014]

GAPDH: a multifunctional enzyme with both glyceraldehyde-3-phosphate dehydrogenase and nitrosylase activities. A key glycolytic enzyme that catalyzes the first step of the pathway by converting D-glyceraldehyde 3-phosphate (G3P) into 3-phospho-D-glyceroyl phosphate. An important enzyme for energy metabolism, and the production of ATP and pyruvate through anaerobic glycolysis in the cytoplasm. Additionally, it participates in apoptosis, membrane trafficking, iron metabolism, nuclear activities and receptor mediated cell signaling. Its subcellular localization changes reflecting its multiple activities. Is cytosolic, but is also localized in the membrane, the nucleus, polysomes, the ER and the Golgi. Participates in transcription, RNA transport, DNA replication and apoptosis. S-nitrosylation on Cys-152 following apoptotic stimulates its interaction with SIAH2, which in turn moderates its translocation into the nucleus. Mediates cysteine S-nitrosylation of nuclear target proteins including SIRT1, HDAC2 and DNA-PK. Deregulated in lung cancer, renal cancer, breast cancer, gastric cancer, glioma, liver cancer, colorectal cancer, melanoma, prostatic cancer, pancreatic cancer and bladder cancer. Its increased expression and enzymatic activity is associated with cell proliferation and tumorigenesis, Oxidative stress impairs GAPDH catalytic activity and leads to cellular aging and apoptosis. In experimental animal models, injection of GAPDH antagonists induces apoptosis and blocks Hep3B tumor progression, suggesting a therapeutic potential of targeting GAPDH in human hepatocellular carcinoma. Protein type: Carbohydrate Metabolism - glycolysis and gluconeogenesis; EC 1.2.1.12; Oxidoreductase. Chromosomal Location of Human Ortholog: 12p13. Cellular Component: cytoplasm; cytosol; extracellular matrix; intracellular membrane-bound organelle; lipid particle; membrane; microtubule cytoskeleton; nuclear membrane; nucleus; plasma membrane; ribonucleoprotein complex; vesicle. Molecular Function: glyceraldehyde-3-phosphate dehydrogenase (phosphorylating) activity; identical protein binding; microtubule binding; protein binding. Biological Process: gluconeogenesis; microtubule cytoskeleton organization and biogenesis; negative regulation of translation; neuron apoptosis; protein stabilization; regulation of macroautophagy

0.1 mg

370 USD

0.5 mg

1045

1 mg

1455