product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human BGP Protein
catalog :
MBS286148
quantity :
0.1 mg
price :
405 USD
more info or order :
MyBioSource product webpage
image
image 1 :
MyBioSource MBS286148 image 1
product information
catalog number :
MBS286148
products type :
Recombinant Protein
products full name :
Recombinant Human BGP Protein
products short name :
[BGP]
products name syn :
[BGP; BGLAP; Osteocalcin]
other names :
[osteocalcin preproprotein; Osteocalcin; osteocalcin; bone gamma-carboxyglutamate protein; Bone Gla protein; BGP; Gamma-carboxyglutamic acid-containing protein]
products gene name :
[BGP]
other gene names :
[BGLAP; BGLAP; OC; BGP; OCN; BGP]
uniprot entry name :
OSTCN_HUMAN
host :
E. coli
sequence length :
100
sequence :
YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQ
EAYR
purity :
> 90 % as determined by SDS-PAGE.
form :
10 mM Tris-HCl, 1 mM EDTA, pH 8.0, 20% glycerol.
concentration :
0.3 mg/mL
storage stability :
Storage: Store it under sterile conditions at -20°C upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage. **Avoid repeated freeze-thaw cycles.**. Stability: The recombinant protein is stable for up to 6 months from date of receipt at -80°C.
tested application :
Western Blot (WB), ELISA (EIA)
image1 heading :
SDS-PAGE
ncbi gi num :
40316933
ncbi acc num :
NP_954642.1
ncbi gb acc num :
NM_199173.5
uniprot acc num :
P02818
ncbi mol weight :
Predicted MW: 32.5 kDa. Observed MW: 32 kDa
ncbi pathways :
FGF Signaling Pathway (137989); Gamma Carboxylation, Hypusine Formation And Arylsulfatase Activation Pathway (1268702); Gamma-carboxylation Of Protein Precursors Pathway (1268704); Gamma-carboxylation, Transport, And Amino-terminal Cleavage Of Proteins Pathway (1268703); Glucocorticoid Receptor Regulatory Network Pathway (138014); Interleukin-11 Signaling Pathway (698753); Metabolism Of Proteins Pathway (1268677); Notch-mediated HES/HEY Network Pathway (169347); Osteoblast Signaling Pathway (198842); Post-translational Protein Modification Pathway (1268701)
ncbi summary :
This gene encodes a highly abundant bone protein secreted by osteoblasts that regulates bone remodeling and energy metabolism. The encoded protein contains a Gla (gamma carboxyglutamate) domain, which functions in binding to calcium and hydroxyapatite, the mineral component of bone. Serum osteocalcin levels may be negatively correlated with metabolic syndrome. Read-through transcription exists between this gene and the neighboring upstream gene, PMF1 (polyamine-modulated factor 1), but the encoded protein only shows sequence identity with the upstream gene product. [provided by RefSeq, Jun 2015]
uniprot summary :
osteocalcin: Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium. Belongs to the osteocalcin/matrix Gla protein family. Protein type: Cell development/differentiation; Secreted; Secreted, signal peptide. Chromosomal Location of Human Ortholog: 1q22. Cellular Component: cytoplasm; endoplasmic reticulum lumen; Golgi lumen. Biological Process: ER to Golgi vesicle-mediated transport; osteoblast differentiation; peptidyl-glutamic acid carboxylation; response to vitamin D; signal peptide processing; skeletal development
size1 :
0.1 mg
price1 :
405 USD
size2 :
0.5 mg
price2 :
1155
size3 :
1 mg
price3 :
1605
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!