Recombinant Human Survivin Protein | MyBioSource MBS286125 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Survivin Protein

catalog :

MBS286125

quantity :

0.1 mg

price :

370 USD

more info or order :

MyBioSource product webpage

image

image 1 :

product information

catalog number :

MBS286125

products type :

Recombinant Protein

products full name :

Recombinant Human Survivin Protein

products short name :

[Survivin]

products name syn :

[BIRC5; API4; EPR-1; Baculoviral Inhibitor Of Apoptosis Repeat Containing 5; Apoptosis Inhibitor 4; Survivin Variant 3 Alpha]

other names :

[baculoviral IAP repeat-containing protein 5 isoform 2; Baculoviral IAP repeat-containing protein 5; baculoviral IAP repeat-containing protein 5; baculoviral IAP repeat containing 5; Apoptosis inhibitor 4; Apoptosis inhibitor survivin]

other gene names :

[BIRC5; BIRC5; API4; EPR-1; API4; IAP4]

uniprot entry name :

BIRC5_HUMAN

host :

E. coli Full length protein(O15392)

sequence length :

137

sequence :

MHHHHHHGAPTLPPAWQPFLKDHRISTFKNWPFLEGCAC
TPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDD
PIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKN
KIAKETNNKKKEFEETAEKVRRAIEQLAAMD

purity :

> 95 % as determined by SDS-PAGE.

form :

In 0.15M PBS, pH 7.4-7.5, 8M urea, 50% glycerol.

concentration :

0.5 mg/mL

storage stability :

Storage: Store it under sterile conditions at -20°C upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage. **Avoid repeated freeze-thaw cycles.**. Stability: The recombinant protein is stable for up to 12 months from date of receipt at -80°C.

image1 heading :

SDS-PAGE

other info1 :

Source: Human

other info2 :

Protein Residues: with N-terminal His-tag. Usage: SURV Protein - Centrifuge the standard vial at 6000-10000rpm for 30s.

products description :

Survivin is a member of the inhibitor of apoptosis (IAP) gene family, which encode negative regulatory proteins that prevent apoptotic cell death. IAP family members usually contain multiple baculovirus IAP repeat (BIR) domains, but this gene encodes proteins with only a single BIR domain. The encoded proteins also lack a C-terminus RING finger domain. Gene expression is high during fetal development and in most tumors yet low in adult tissues. Antisense transcripts are involved in the regulation of this gene's expression. At least four transcript variants encoding distinct isoforms have been found for this gene, but the full-length natures of only three of them have been determined.

ncbi gi num :

59859880

ncbi acc num :

NP_001012270.1

ncbi gb acc num :

NM_001012270.1

uniprot acc num :

O15392

ncbi mol weight :

17 kDa

ncbi pathways :

Apoptosis Pathway (83060); Apoptosis Pathway (198797); Apoptosis Pathway (470); Apoptosis - Multiple Species Pathway (1384747); Apoptosis - Multiple Species Pathway (1384709); Apoptosis Modulation And Signaling Pathway (198822); Apoptosis-related Network Due To Altered Notch3 In Ovarian Cancer Pathway (1458189); Aurora A Signaling Pathway (137925); Aurora B Signaling Pathway (138080); Cell Cycle Pathway (1269741)

ncbi summary :

This gene is a member of the inhibitor of apoptosis (IAP) gene family, which encode negative regulatory proteins that prevent apoptotic cell death. IAP family members usually contain multiple baculovirus IAP repeat (BIR) domains, but this gene encodes proteins with only a single BIR domain. The encoded proteins also lack a C-terminus RING finger domain. Gene expression is high during fetal development and in most tumors, yet low in adult tissues. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jun 2011]

uniprot summary :

Survivin: an apoptosis inhibitor that is expressed during the G2/M phase of the cell cycle. Associates with the microtubules of the mitotic spindle and any disruption results in the loss of apoptosis activity. May play a role in neoplasia. Inhibitor of caspase-3 and caspase-7. Two splice variant isoforms have been described. Protein type: Apoptosis. Chromosomal Location of Human Ortholog: 17q25. Cellular Component: chromosome, pericentric region; cytoplasm; cytosol; midbody; nuclear chromosome; nucleoplasm; nucleus. Molecular Function: chaperone binding; enzyme binding; identical protein binding; microtubule binding; protein binding; Ran GTPase binding; ubiquitin-protein ligase activity. Biological Process: negative regulation of apoptosis; negative regulation of transcription, DNA-dependent; positive regulation of cell proliferation; protein amino acid phosphorylation; protein complex localization; protein sumoylation; regulation of apoptosis; regulation of signal transduction; sister chromatid cohesion

size1 :

0.1 mg

price1 :

370 USD

size2 :

0.5 mg

price2 :

1045

size3 :

1 mg

price3 :

1455

more info or order :

MyBioSource product webpage