Recombinant Human MMP1 Protein, Recombinant Human Matrix Metalloproteinase 1(MMP1) Protein | MyBioSource MBS286117 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human MMP1 Protein, Recombinant Human Matrix Metalloproteinase 1(MMP1) Protein

catalog :

MBS286117

quantity :

0.1 mg

price :

370 USD

more info or order :

MyBioSource product webpage

image

image 1 :

product information

catalog number :

MBS286117

products type :

Recombinant Protein

products full name :

Recombinant Human MMP1 Protein, Recombinant Human Matrix Metalloproteinase 1(MMP1) Protein

products short name :

[MMP1]

products name syn :

[CLGN; CLG1; Collagenase; Interstitial Collagenase; Vertebrate Collagenase; Fibroblast Collagenase]

other names :

[interstitial collagenase isoform 1 preproprotein; Interstitial collagenase; interstitial collagenase; matrix metallopeptidase 1; Fibroblast collagenase; Matrix metalloproteinase-1; MMP-1]

products gene name :

[MMP1]

other gene names :

[MMP1; MMP1; CLG; CLGN; CLG; MMP-1]

uniprot entry name :

MMP1_HUMAN

host :

E. coli AA 101-469 (P03956).

sequence positions :

[101-469]

sequence length :

469

sequence :

VLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQ
LWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPG
GNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAA
HELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGI
QAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVM
FFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEF
ADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRT
VKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYP
KMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKT
KRILTLQKANSWFNCRKN

purity :

> 90 % as determined by SDS-PAGE.

form :

In 10 mM Tris-HCl, 1 mM EDTA, pH 8.0, 50% glycerol.

concentration :

0.8 mg/mL

storage stability :

Store it under sterile conditions at -20°C upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage. **Avoid repeated freeze-thaw cycles.**. Stability: The recombinant protein is stable for up to 6 months from date of receipt at -80°C.

tested application :

Western Blot (WB), ELISA (EIA)

image1 heading :

SDS-PAGE

other info1 :

Source: Human. Predicted Molecular Mass: Predicted MW: 46.5 kDa. Observed MW: 46.5 kDa

other info2 :

Protein Residues: with N-terminal 6×His-tag. Usage: MMP1 Protein - Centrifuge the standard vial at 6000-10000rpm for 30s.

products description :

MMP-1 is produced by fibroblasts, chondrocytes, macrophages, endothelial cells, and osteoblasts. It is induced by the pro-inflammatory cytokines IL-1 and TNF-alpha, various growth factors such as EGF, PDGF, FGF basic, and Oncostatin M, chemical agents such as cAMP and phorbol esters and events occurring at the cell surface such as cell fusion and phagocytosis. MMP-1 plays a significant role in the degradation of different types of collagen in extracellular matrix remodeling. It is implicated in a variety of processes involving collagen degradation such as emphysema, atherosclerosis, rheumatoid and osteoarthritis, periodontal and respiratory disease, angiogenesis and tumorigenesis, tissue remodeling and wound healing, and inflammatory bowel disease.

ncbi gi num :

4505215

ncbi acc num :

NP_002412.1

ncbi gb acc num :

NM_002421.3

uniprot acc num :

P03956

ncbi pathways :

Activation Of Matrix Metalloproteinases Pathway (1270258); Basigin Interactions Pathway (1269376); Bladder Cancer Pathway (1458294); Bladder Cancer Pathway (83115); Bladder Cancer Pathway (527); Cell Surface Interactions At The Vascular Wall Pathway (1269373); Collagen Degradation Pathway (1270259); Cytokine Signaling In Immune System Pathway (1269310); Degradation Of The Extracellular Matrix Pathway (1270257); Endothelins Pathway (137958)

ncbi summary :

This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded preproprotein is proteolytically processed to generate the mature protease. This secreted protease breaks down the interstitial collagens, including types I, II, and III. The gene is part of a cluster of MMP genes on chromosome 11. Mutations in this gene are associated with chronic obstructive pulmonary disease (COPD). Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Jan 2016]

uniprot summary :

MMP1: Cleaves collagens of types I, II, and III at one site in the helical domain. Also cleaves collagens of types VII and X. In case of HIV infection, interacts and cleaves the secreted viral Tat protein, leading to a decrease in neuronal Tat's mediated neurotoxicity. Belongs to the peptidase M10A family. Protein type: EC 3.4.24.7; Motility/polarity/chemotaxis; Protease; Secreted; Secreted, signal peptide. Chromosomal Location of Human Ortholog: 11q22.3. Cellular Component: extracellular region. Molecular Function: endopeptidase activity; metalloendopeptidase activity; serine-type endopeptidase activity. Biological Process: cellular protein metabolic process; collagen catabolic process; extracellular matrix disassembly; leukocyte migration; positive regulation of protein oligomerization; proteolysis. Disease: Epidermolysis Bullosa Dystrophica, Autosomal Recessive; Pulmonary Disease, Chronic Obstructive

size1 :

0.1 mg

price1 :

370 USD

size2 :

0.5 mg

price2 :

1045

size3 :

1 mg

price3 :

1455

more info or order :

MyBioSource product webpage