protein

Recombinant Human Chorionic Gonadotropin Beta (beta-HCG)

MBS283663

0.1 mg

370 USD

Recombinant Protein

Recombinant Human Chorionic Gonadotropin Beta (beta-HCG)

[Chorionic Gonadotropin Beta]

[CG-B; CGB3; hCGB; HCG; CGb; CGb5; CGb7; CGb8; Choriogonadotropin subunit beta]

[beta-HCG]

[hCG]

E. coli AA 1-165 (P0DN86).

[]

CQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ
MEMFQGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVE
KEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCN
YRDVRFESIRLPGCPRGVNPVVSYAVALS

> 90 % as determined by SDS-PAGE.

Powder. 58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH 7.4 added with 5 % trehalose and 5 % mannitol are added as protectants before lyophilization

1 mg/mL

Store it under sterile conditions at -20°C upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage.**Avoid repeated freeze-thaw cycles.**. The recombinant protein is stable for up to 6 months from date of receipt at -80°C.

Western Blot (WB), ELISA (EIA)

Western blotting, ELISA, Albumin-bound fluorescence was used in serum of patients with chronic renal failure.

SDS-PAGE

Source: Human . Protein Residue: with His-tag. Protein Residues: with N-terminal 6-His. Predicted MW: 22 kDa. Observed MW: 22 kDa

Usage: beta-HCG Protein-Centrifuge the standard vialat6000-10000 rpm for 30s.Reconstitute at 0.25mg/mL in 200 uL sterile water for short-term storage. Reconstitution with 200 uL 50% glycerol solution is recommended for long term storage. Swirl or mix gently to insure complete and homogeneous solubilization.

By restriction digest analysis, Talmadge et al. (1983) determined that the 7 CGB genes are extremely similar but not identical. Otani et al. (1988) found that CGB3 and CBG8 were expressed at 2-fold lower levels than CGB5 following transfection into a mouse adrenocortical cell line. Bo and Boime (1992) determined that most of the sequence variation among the CGB genes occurs in the nontranslated region of exon 1. They further found that CGB3 was expressedat about the same levels at CGB8 in first trimester placenta and in a choriocarcinoma cell line, and both were expressed at a lower level than CGB5. Jameson and Lindell (1988) determined that each of the CGB genes contains 3 exons. Otani et al. (1988) determined that the promoter regions contain no CAAT. or TATAA boxes.

0.1 mg

370 USD

0.5 mg

1045

1 mg

1455