product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Cytokeratin Fragment Antigen 21-1 (CYFRA21-1)
catalog :
MBS283658
quantity :
0.1 mg
price :
405 USD
more info or order :
MyBioSource product webpage
image
image 1 :
MyBioSource MBS283658 image 1
product information
catalog number :
MBS283658
products type :
Recombinant Protein
products full name :
Recombinant Human Cytokeratin Fragment Antigen 21-1 (CYFRA21-1)
products short name :
[Cytokeratin Fragment Antigen 21-1]
products name syn :
[K1C19_HUMAN;Keratin,typeIcytoskeletal19;Cytokeratin-19;CK-19;Keratin-19;K19]
products gene name :
[CYFRA21-1]
host :
E Coli
sequence :
EKLTMQNLNDRLASYLDKVRALEAANGELEVKIRDWYQK
QGPGPSRDYSHYYTTIQDLRDKILGATIENSRIVLQIDN
ARLAADDFRTKFETEQALRMSVEADINGLRRVLDELTLA
RTDLEMQIEGLKEELAYLKKNHEEEISTLRGQVGGQVSV
EVDSAP
purity :
>95 % as determined by SDS-PAGE
form :
58 mM Na 2 HPO 4 , 17 mM NaH 2 PO 4 , 68 mM NaCl, 300 mM Imidazole, pH 8.0,Trehalose (5-8%) and mannitol (5-8%) protectants were added before lyophilization
concentration :
0.8 mg/mL
storage stability :
Store it under sterile conditions at -20°C upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage. Avoid repeated freeze-thaw cycles. The recombinant protein is stable for up to 6 months from date of receipt at -80°C.
tested application :
Western Blot (WB), ELISA (EIA)
app notes :
Western blotting, ELISA, Albumin-bound fluorescence was used in serum of patients with chronic renal failure.
image1 heading :
SDS
other info1 :
Predicted MW: 62 kDa. Observed MW: 62 kDa. Usage: CYFRA21-1 Protein - Centrifuge the standard vial at 6000-10000rpm for 30s.
other info2 :
Endotoxin: < 1.0 EU per ug of the protein as determined by the LAL method. Storage Buffer: The protein solution is in 0.05M phosphate buffer containing 0.15M NaCl and 0.09% NaN3 pH 7.5. Filtered through a 0.4uM membrane. Protein Residues: with N-terminal GST.
products description :
Cytokeratin19 Fragment Antigen 21-1(CYFRA21-1) belongs to a family of 20 related polypeptides that are constituents of the intermediate filaments of epithelial cells. Of these CK19 is the most frequently expressed cytokeratin endometrial cancer. CYFRA21-1 is a common tumor marker of lung cancer,non-small-cell cancer, small cell carcinoma and squamous cell carcinoma. For breast cancer, CYFRA21-1 may be comparable to the sensitivity and specificity of CA153. Measured jointly with any of the tumor markers as CEA, SCCA, NSE, can increase the sensitivity. Other as bladder cancer, nasopharyngeal cancer, ovarian cancer, gastrointestinal cancer, and also have certain positive rate. CYFRA21-1 in hepatitis, pancreatitis, pneumonia, benign prostatic hyperplasia may also be increased.
size1 :
0.1 mg
price1 :
405 USD
size2 :
0.5 mg
price2 :
1155
size3 :
1 mg
price3 :
1605
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!