LLKQIEFLKGQLPEAPVIGKQTPSLPPSLPGLRPRFPVL
LASSTRGRQVDIRGVPRGVHLGSQGLQRGFQHPSPRGRS
LPQRGVDCLSSHFQELSIYQDQEQRILKFLEELGEGKAT
TAHDLSGKLGTPKKEINRVL

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- A Disintegrin And Metalloproteinase With Thrombospondin 2 (ADAMTS2)
- Flagellin protein
- Heterogeneous Nuclear Ribonucleoprotein A2/B1 (HNRPA2B1)
- A Disintegrin And Metalloproteinase With Thrombospondin 12 (ADAMTS12)
- DNA Methyltransferase 1 (DNMT1)
- A Disintegrin And Metalloprotease 10 (ADAM10)
- Mucin 2 (MUC2)
- Recombinant Human Epididymis protein 4 (HE4)
