MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTD
DDDKAMADIGSEF-YLG

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- A Disintegrin And Metalloproteinase With Thrombospondin 7 (ADAMTS7)
- A Disintegrin And Metalloprotease 5 (ADAM5)
- A Disintegrin And Metalloprotease 17 (ADAM17)
- Cytochrome C, Somatic (CYCS)
- A Disintegrin And Metalloprotease 6 (ADAM6)
- S100 Calcium Binding Protein A9 (S100A9)
- Aspartate Aminotransferase 2 (AST2)
- Serum Amyloid A (SAA)
