product summary
request information :
company name :
MyBioSource
product type :
protein
product name :
Major royal jelly protein 1
catalog :
MBS253233
quantity :
0.01 mg
price :
285 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS253233
products type :
Recombinant Protein
products full name :
Major royal jelly protein 1
products short name :
Major royal jelly protein 1
other names :
major royal jelly protein 1; Major royal jelly protein 1; major royal jelly protein 1; MRJP-1; royalactin; milk protein; 56-kDa protein 4; bee-milk protein; major royal jelly protein 1<; 56-kDa protein 4; p56kP-4; Bee-milk protein; RoyalactinCleaved into the following 3 chains:Jellein-1Alternative name(s):Jelleine-I
other gene names :
Mrjp1; MRJP1; GB14888; p56kP-4; MRJP-1; p56kP-4
uniprot entry name :
MRJP1_APIME
host :
E Coli
sequence length :
432
sequence :
RYNGVPSSLNVISKKVGDGGPLLQPYPDWSFAKYDDCSGIVSASKLAIDKCDRLWVLDSGL VNNTQPMCSPKLLTFDLTTSQLLI<QVEIPHDVAVNATTGKGRLSSLAVQSLDCNTNSDTMV Y'ADEKGEGLIVYHNSDDSFHRLTSNTFDYDPKFTKMTIDGESYTAQDGISGMALSPMTNNL YYSPVASTSLYYVNTEQFRTSDYQQNDIHYEGVQNILDTQSSAKWSKSGVLFFGLVGDSA LGCWNEHRTLERHNIRTVAQSDETLQMIASMKIKEALPHVPIFDRYINREYILVLSNKMQKMV r·mDFNFDDVNFRIMNANVNElILlHRCENPDNDRTPFKISIHL
NILRGESLNKSLPILHEWKFFDYDFGSDERRQDAILSGE
YDYKNNYPSDIDQWHDKIFVTML
purity :
>90%(SDS-PAGE)
storage stability :
Store at -20 Degree C, for extended storage, conserve at -20Degree C or -80Degree C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 Degree C for up to one week.
other info1 :
Tag Information: GST-tagged
other info2 :
Organism: Apis mellifera. Storage Buffer: PBS, pH 7.4, 50% glycerol
products description :
Major royal jelly protein 1: induces the differentiation of honeybee larvae into queens through an Egfr-mediated signaling pathway. Promotes body size increase by activating p70 S6 kinase, stimulates ovary development by augmenting the titer of vitellogenin (Vg) and juvenile hormone, and reduces developmental time by increasing the activity of mitogen-activated protein kinase and inducing the 20-hydroxyecdysone protein (20E). Most abundant protein found in the royal jelly which is the food of the queen honey bee larva. The royal jelly determines the development of the young larvae and is responsible for the high reproductive ability of the honeybee queen.
ncbi gi num :
58585098
ncbi acc num :
NP_001011579.1
ncbi gb acc num :
NM_001011579.1
ncbi mol weight :
71kd
size :
0.01 mg
price :
285 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!