product summary
request information :
company name :
MyBioSource
product type :
protein
product name :
Collagenase 3
catalog :
MBS251540
quantity :
0.01 mg
price :
285 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS251540
products type :
Recombinant Protein
products full name :
Collagenase 3
products short name :
Collagenase 3
other names :
collagenase 3 preproprotein; Collagenase 3; collagenase 3; matrix metalloproteinase 13 (collagenase 3); matrix metallopeptidase 13 (collagenase 3); Matrix metalloproteinase-13; MMP-13
products gene name :
Collagenase 3
other gene names :
MMP13; MMP13; CLG3; MANDP1; MMP-13; MMP-13
uniprot entry name :
MMP13_HUMAN
host :
E Coli
sequence length :
471
sequence :
YNVFPRTLKWSQTNLTYRIVNYTPDMSHSEVEKAFRKAF
KVWSDVTPLNFTRIYDGTADIMISFGTKEHGDFYPFDGP
SGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFIVA
AHELGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDV
QGIQFLYGPGDEDPNPKHPKTPEKCDPALSLDAITSLRG
ETMIFKDRFFWRLHPQQVEAELFLTKSFWPELPNHVDAA
YEHPSRDLMFIFRGRKFWALNGYDILEGYPRKISDLGFP
KEVKRLSAAVHFENTGKTLFFSENHVWSYDDVNQTMDKD
YPRLIEEEFPGIGNKVDAVYEKNGYIYFFNGPIQFEYSI
WSNRIVRVMPTNSILWC
purity :
>90% (SDS-PAGE)
form :
Supplied in solution; 20mM Tris-HCl, 0.5M Arg, pH 8.0, 50% glycerol.
storage stability :
Store at 2-8 degree C for one month; for long term storage, store at -20 degree C or -80 degree C.
other info1 :
Tag Information: His tag
other info2 :
Organism: Mus musculus (Mouse)
products description :
Degrades collagen type I
ncbi gi num :
4505209
ncbi acc num :
NP_002418.1
ncbi gb acc num :
NM_002427.3
ncbi mol weight :
45kDa
ncbi pathways :
AGE/RAGE Pathway 698754!!Activation Of Matrix Metalloproteinases Pathway 576264!!Assembly Of Collagen Fibrils And Other Multimeric Structures Pathway 730306!!Collagen Degradation Pathway 730309!!Collagen Formation Pathway 645288!!Degradation Of The Extracellular Matrix Pathway 576263!!Endochondral Ossification Pathway 198812!!Extracellular Matrix Organization Pathway 576262!!Matrix Metalloproteinases Pathway 198900!!Oncostatin M Signaling Pathway 711361
ncbi summary :
Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The protein encoded by this gene cleaves type II collagen more efficiently than types I and III. It may be involved in articular cartilage turnover and cartilage pathophysiology associated with osteoarthritis. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3. [provided by RefSeq, Jul 2008]
size :
0.01 mg
price :
285 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!