product summary
request information :
company name :
MyBioSource
product type :
protein
product name :
Collagen alpha-3(VI) chain
catalog :
MBS250810
quantity :
0.01 mg
price :
285 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS250810
products type :
Recombinant Protein
products full name :
Collagen alpha-3(VI) chain
products short name :
Collagen alpha-3(VI) chain
other names :
collagen alpha-3(VI) chain isoform 5; Collagen alpha-3(VI) chain; collagen alpha-3(VI) chain; collagen alpha-3(VI) chain; collagen VI, alpha-3 polypeptide; collagen, type VI, alpha 3; N/A
other gene names :
COL6A3; COL6A3; N/A
uniprot entry name :
CO6A3_HUMAN
host :
E Coli
sequence length :
2971
sequence :
HKQVNVPNNVTSSPTSNPVTTTKPVTTTKPVTTTTKPVT
TTTKPVTIINQPSVKPAAAKPAPAKPVAAKPVATKMATV
RPPVAVKPATAAKPVAAKPAAVRPPAAAAAKPVATKPEV
PRPQAAKPAATKPATTKPMVKMSREVQVFEITENSAKLH
WERAEPPGPYFYDLTVTSAHDQSLVLKQNLTVTDRVIGG
LLAGQTYHVAVVCYLRSQVRATYHGSFSTKKSQPPPPQP
ARSASSSTINLMVSTEPLALTETDICKLPKDEGTCRDFI
LKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCAP
VLAKPGVISVMG
other info1 :
Tag Information: His tag
other info2 :
Organism: Homo sapiens (Human)
ncbi gi num :
55743106
ncbi acc num :
NP_476508.2
ncbi gb acc num :
NM_057167.3
ncbi mol weight :
134,707 Da
ncbi pathways :
Assembly Of Collagen Fibrils And Other Multimeric Structures Pathway 730306!!Axon Guidance Pathway 105688!!Collagen Biosynthesis And Modifying Enzymes Pathway 645289!!Collagen Formation Pathway 645288!!Developmental Biology Pathway 477129!!ECM-receptor Interaction Pathway 83068!!ECM-receptor Interaction Pathway 479!!Extracellular Matrix Organization Pathway 576262!!Focal Adhesion Pathway 83067!!Focal Adhesion Pathway 478
ncbi summary :
This gene encodes the alpha-3 chain, one of the three alpha chains of type VI collagen, a beaded filament collagen found in most connective tissues. The alpha-3 chain of type VI collagen is much larger than the alpha-1 and -2 chains. This difference in size is largely due to an increase in the number of subdomains, similar to von Willebrand Factor type A domains, that are found in the amino terminal globular domain of all the alpha chains. These domains have been shown to bind extracellular matrix proteins, an interaction that explains the importance of this collagen in organizing matrix components. Mutations in the type VI collagen genes are associated with Bethlem myopathy, a rare autosomal dominant proximal myopathy with early childhood onset. Mutations in this gene are also a cause of Ullrich congenital muscular dystrophy, also referred to as Ullrich scleroatonic muscular dystrophy, an autosomal recessive congenital myopathy that is more severe than Bethlem myopathy. Multiple transcript variants have been identified, but the full-length nature of only some of these variants has been described. [provided by RefSeq, Jun 2009]
size :
0.01 mg
price :
285 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!