KGDDIIDGGNGDDFIDGGKGNDLLHGGKGDDIFVHRQGD
GNDSITESEGNDKLSFSDSNLKDLTFEKVNHHLVITNTK
QEKVTIQNWFREAEFAKTIQNYVATRDDKIEEIIGQNGE
RITSKQVDELIEKGNGKIAQSELTKVVDNYQLLKYSRDA
SNSLDKLISSASAFTSSNDSRNVLASPTSMLDPSLSSIQ
FARAA

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Hydroxyacylglutathione hydrolase, mitochondrial
- Thyroglobulin (TG)
- Collagen alpha-3(VI) chain
- A Disintegrin And Metalloprotease 15 (ADAM15)
- Native Advanced Glycation End Product (AGE)
- A Disintegrin And Metalloprotease 10 (ADAM10)
- Mucin 1 (MUC1)
- A Disintegrin And Metalloproteinase With Thrombospondin 7 (ADAMTS7)
