catalog number :
MBS238022
products full name :
SYNTHETIC HUMAN ACTH (aa1-39)
products short name :
ACTH
other names :
pro-opiomelanocortin preproprotein; Pro-opiomelanocortin; pro-opiomelanocortin; adrenocorticotropic hormone; adrenocorticotropin; alpha-MSH; alpha-melanocyte-stimulating hormone; beta-LPH; beta-MSH; beta-endorphin; beta-melanocyte-stimulating hormone; corticotropin-like intermediary peptide; corticotropin-lipotropin; gamma-LPH; gamma-MSH; lipotropin beta; lipotropin gamma; melanotropin alpha; melanotropin beta; melanotropin gamma; met-enkephalin; opiomelanocortin prepropeptide; pro-ACTH-endorphin; proopiomelanocortin preproprotein; proopiomelanocortin; Corticotropin-lipotropinCleaved into the following 11 chains:NPP; Melanotropin gammaAlternative name(s):Gamma-MSH
products gene name :
ACTH
other gene names :
POMC; POMC; LPH; MSH; NPP; POC; ACTH; CLIP; POMC; ACTH; CLIP
uniprot entry name :
COLI_HUMAN
sequence :
SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
form :
Purified. Purified synthetic ACTH - liquid
concentration :
Total protein concentration 1.0mg/ml
storage stability :
Store at -20 degree C only. Storage in frost-free freezers is not recommended. This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the protein. Should this product contain a precipitate we recommend microcentrifugation before use. Shelf Life: 18 months from date of despatch.
tested application :
ELISA (EIA)
other info1 :
Preparation: Solid phase synthesis
other info2 :
Buffer Solution: Trifluoroacetate salt. Target Species: Human
products description :
It is a synthetic peptide corresponding to full-length mature human ACTH, a secreted hormone that stimulates the synthesis and release of corticosteroids from the adrenal cortex.
ncbi acc num :
NP_000930.1
ncbi gb acc num :
NM_000939.2
ncbi mol weight :
4541 Da
ncbi pathways :
Adipocytokine Signaling Pathway (83093); Adipocytokine Signaling Pathway (505); Androgen Biosynthesis Pathway (106154); Biological Oxidations Pathway (105698); Class A/1 (Rhodopsin-like Receptors) Pathway (106357); Corticotropin-releasing Hormone Pathway (920957); Cytochrome P450 - Arranged By Substrate Type Pathway (105700); Defective ACTH Causes Obesity And Pro-opiomelanocortinin Deficiency (POMCD) Pathway (1127664); Defective CYP11A1 Causes Adrenal Insufficiency, Congenital, With 46,XY Sex Reversal (AICSR) Pathway (1127640); Defective CYP11B1 Causes Adrenal Hyperplasia 4 (AH4) Pathway (1127641)
ncbi summary :
This gene encodes a polypeptide hormone precursor that undergoes extensive, tissue-specific, post-translational processing via cleavage by subtilisin-like enzymes known as prohormone convertases. There are eight potential cleavage sites within the polypeptide precursor and, depending on tissue type and the available convertases, processing may yield as many as ten biologically active peptides involved in diverse cellular functions. The encoded protein is synthesized mainly in corticotroph cells of the anterior pituitary where four cleavage sites are used; adrenocorticotrophin, essential for normal steroidogenesis and the maintenance of normal adrenal weight, and lipotropin beta are the major end products. In other tissues, including the hypothalamus, placenta, and epithelium, all cleavage sites may be used, giving rise to peptides with roles in pain and energy homeostasis, melanocyte stimulation, and immune modulation. These include several distinct melanotropins, lipotropins, and endorphins that are contained within the adrenocorticotrophin and beta-lipotropin peptides. The antimicrobial melanotropin alpha peptide exhibits antibacterial and antifungal activity. Mutations in this gene have been associated with early onset obesity, adrenal insufficiency, and red hair pigmentation. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq, Nov 2014]
uniprot summary :
POMC: ACTH stimulates the adrenal glands to release cortisol. Defects in POMC may be associated with susceptibility to obesity (OBESITY). It is a condition characterized by an increase of body weight beyond the limitation of skeletal and physical requirements, as the result of excessive accumulation of body fat. Defects in POMC are the cause of pro-opiomelanocortinin deficiency (POMCD). Affected individuals present early-onset obesity, adrenal insufficiency and red hair. Belongs to the POMC family. Protein type: Secreted; Secreted, signal peptide. Chromosomal Location of Human Ortholog: 2p23.3. Cellular Component: extracellular space; peroxisomal matrix; cytoplasm; extracellular region; peroxisome; secretory granule. Molecular Function: type 3 melanocortin receptor binding; G-protein-coupled receptor binding; type 4 melanocortin receptor binding; hormone activity; receptor binding. Biological Process: generation of precursor metabolites and energy; cellular protein metabolic process; cell-cell signaling; neuropeptide signaling pathway; regulation of blood pressure; peptide hormone processing; regulation of appetite; positive regulation of transcription from RNA polymerase II promoter; negative regulation of tumor necrosis factor production; signal transduction; glucose homeostasis; cellular pigmentation. Disease: Obesity; Proopiomelanocortin Deficiency