catalog number :
MBS217292
products full name :
MOUSE ANTI HUMAN ACTIVIN BetaC-SUBUNIT
products short name :
ACTIVIN Beta
other names :
inhibin beta C chain preproprotein; Inhibin beta C chain; inhibin beta C chain; activin beta-C chain; inhibin, beta C; Activin beta-C chain
other gene names :
INHBC; INHBC; IHBC; N/A
uniprot entry name :
INHBC_HUMAN
form :
Purified. Purified IgG - liquid
concentration :
IgG concentration 0.5mg/ml
storage stability :
Store at 4 degree C or at -20 degree C if preferred. Storage in frost-free freezers is not recommended. This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use. Shelf Life: 18 months from date of despatch.
tested application :
ELISA (EIA), Immunohistology Paraffin*, Western Blot (WB)
app notes :
Immunohistology - Paraffin: Application Note: This product requires antigen retrieval using heat treatment prior to staining of paraffin sections, 0.01 mol/L glycine buffer solution (pH 4.4) is recommended for this purpose. See Mellor et al. for details. . Western Blotting: Maximum Dilution: 1/5000
other info1 :
Perservative Stabilisers: 0.09% Sodium Azide (NaN3) . Preparation: Purified IgG prepared by affinity chromatography on Protein G from tissue culture supernatant
other info2 :
Immunogen: Synthetic peptide sequence VPTARRPLSLLYYDRDSNIVKTDIPDMVVEAC corresponding to amino acids 82-113 of mature human activin BetaC-subunit. Histology Positive Control Tissue: Liver. Staining localises to hepatocytes. Buffer Solution: Phosphate buffered saline. Target Species: Human
products description :
Mouse anti Human Activin betaC-subunit antibody, clone betaC clone 1 recognizes the BetaC-subunit of Activin (BetaC-activin), a member of the transforming growth factor beta (TGF-beta) superfamily and one of a group of proteins which regulate growth and differentiation in a range of cells and tissues, via both autocrine and paracrine pathways. Activins were originally characterised by the formation of specific homo- and heterodimers of activin BetaA- or BetaB-subunits, but additional subunits of activin have since been identified including BetaC, BetaD and BetaE. BetaC-activin, expressed in the liver, prostrate, ovary and testis, has been shown to exhibit both growth promoting and inhibitory properties, and evidence suggests that BetaC-activin can form BetaC homodimers and also heterodimers with BetaA (putative activin AC) and BetaB (putative activin BC). Clone betaC clone 1 has been shown to recognize both monomeric and dimeric BetaC-activin and does not cross react with BetaAf, BetaB or BetaE.
ncbi acc num :
NP_005529.1
ncbi gb acc num :
NM_005538.3
ncbi mol weight :
38,238 Da
ncbi pathways :
Activin Signaling Pathway 1084757!!Activin Signaling Pathway 1108220!!Cytokine-cytokine Receptor Interaction Pathway 83051!!Cytokine-cytokine Receptor Interaction Pathway 460!!Glycoprotein Hormones Pathway 160989!!Metabolism Of Proteins Pathway 106230!!Peptide Hormone Biosynthesis Pathway 160988!!Peptide Hormone Metabolism Pathway 771603!!Signaling Pathways Regulating Pluripotency Of Stem Cells 1026136!!Signaling Pathways Regulating Pluripotency Of Stem Cells 1033502
ncbi summary :
This gene encodes the beta C chain of inhibin, a member of the TGF-beta superfamily. This subunit forms heterodimers with beta A and beta B subunits. Inhibins and activins, also members of the TGF-beta superfamily, are hormones with opposing actions and are involved in hypothalamic, pituitary, and gonadal hormone secretion, as well as growth and differentiation of various cell types. [provided by RefSeq, Jul 2008]