This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
MyBioSource
product type :
antibody
product name :
MOUSE ANTI HUMAN ACTIVIN BetaC-SUBUNIT
catalog :
MBS214372
quantity :
0.05 mg
price :
320 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
betaC 1
reactivity :
human
application :
western blot, ELISA, enzyme immunoassay
product information
catalog number :
MBS214372
products type :
Antibody
products full name :
MOUSE ANTI HUMAN ACTIVIN BetaC-SUBUNIT
products short name :
ACTIVIN Beta
other names :
inhibin beta C chain preproprotein; Inhibin beta C chain; inhibin beta C chain; activin beta-C chain; inhibin, beta C; Activin beta-C chain
other gene names :
INHBC; INHBC; IHBC
uniprot entry name :
INHBC_HUMAN
clonality :
Monoclonal
isotype :
IgG1
clone :
betaC clone 1
host :
Mouse
sequence length :
352
form :
Purified. Purified IgG - liquid
concentration :
IgG concentration 0.5mg/ml
storage stability :
Store at 4 degree C or at -20 degree C if preferred. Storage in frost-free freezers is not recommended. This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use. Shelf Life: 18 months from date of despatch.
tested application :
ELISA (EIA), Immunohistology Paraffin*, Western Blot (WB)
app notes :
Immunohistology - Paraffin: Application Note: This product requires antigen retrieval using heat treatment prior to staining of paraffin sections, 0.01 mol/L glycine buffer solution (pH 4.4) is recommended for this purpose. See Mellor et al. for details. . Western Blotting: Maximum Dilution: 1/5000
other info1 :
Perservative Stabilisers: 0.09% Sodium Azide (NaN3) . Preparation: Purified IgG prepared by affinity chromatography on Protein G from tissue culture supernatant
other info2 :
Immunogen: Synthetic peptide sequence VPTARRPLSLLYYDRDSNIVKTDIPDMVVEAC corresponding to amino acids 82-113 of mature human activin BetaC-subunit. Histology Positive Control Tissue: Liver. Staining localises to hepatocytes. Buffer Solution: Phosphate buffered saline. Target Species: Human
products description :
Mouse anti Human Activin betaC-subunit antibody, clone betaC clone 1 recognizes the BetaC-subunit of Activin (BetaC-activin), a member of the transforming growth factor beta (TGF-beta) superfamily and one of a group of proteins which regulate growth and differentiation in a range of cells and tissues, via both autocrine and paracrine pathways. Activins were originally characterised by the formation of specific homo- and heterodimers of activin BetaA- or BetaB-subunits, but additional subunits of activin have since been identified including BetaC, BetaD and BetaE. BetaC-activin, expressed in the liver, prostrate, ovary and testis, has been shown to exhibit both growth promoting and inhibitory properties, and evidence suggests that BetaC-activin can form BetaC homodimers and also heterodimers with BetaA (putative activin AC) and BetaB (putative activin BC). Clone betaC clone 1 has been shown to recognize both monomeric and dimeric BetaC-activin and does not cross react with BetaAf, BetaB or BetaE.
ncbi gi num :
5031795
ncbi acc num :
NP_005529.1
ncbi gb acc num :
NM_005538.3
uniprot acc num :
P55103
ncbi mol weight :
38,238 Da
ncbi pathways :
Activin Signaling Pathway 1084757!!Activin Signaling Pathway 1108220!!Cytokine-cytokine Receptor Interaction Pathway 83051!!Cytokine-cytokine Receptor Interaction Pathway 460!!Glycoprotein Hormones Pathway 160989!!Metabolism Of Proteins Pathway 106230!!Peptide Hormone Biosynthesis Pathway 160988!!Peptide Hormone Metabolism Pathway 771603!!Signaling Pathways Regulating Pluripotency Of Stem Cells 1026136!!Signaling Pathways Regulating Pluripotency Of Stem Cells 1033502
ncbi summary :
This gene encodes the beta C chain of inhibin, a member of the TGF-beta superfamily. This subunit forms heterodimers with beta A and beta B subunits. Inhibins and activins, also members of the TGF-beta superfamily, are hormones with opposing actions and are involved in hypothalamic, pituitary, and gonadal hormone secretion, as well as growth and differentiation of various cell types. [provided by RefSeq, Jul 2008]
size :
0.05 mg
price :
320 USD
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!