catalog number :
MBS2011362
products type :
Recombinant Protein
products full name :
Recombinant Cathepsin S (CTSS)
products short name :
Cathepsin S (CTSS)
other names :
cathepsin S isoform 2 preproprotein; Cathepsin S; cathepsin S; Cat S; cathepsin S
products gene name :
CTSS
other gene names :
Ctss; Ctss; Cats
uniprot entry name :
CATS_MOUSE
sequence :
EKGCVTEVKY QGSCGACWAF SAVGALEGQL KLKTGKLISL SAQNLVDCSN EEKYGNKGCG GGYMTEAFQY IIDNGGIEAD ASYPYKATDE KCHYNSKNRA ATCSRYIQLP FGDEDALKEA VATKGPVSVG IDASHSSFFF YKSGVYDDPS CTGNVNHGVL VVGYGTLDGK DYWLVKNSWG LNFGDQGYIR MARNNKNHCG IASYCSYPE
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTD
DDDKAMADIGSEF-LPDTVDWR
The target protein is fused with two N-terminal Tags, His-tag and S-tag Form & Buffer: Supplied as solution form in PBS, pH 74, con, its sequence is listed below.
form :
Supplied as lyophilized form in PBS,pH7.4, containing 5% sucrose, 0.01% sarcosyl.
storage stability :
Avoid repeated freeze/thaw cycles. Store at 2-8 degree C for one month. Aliquot and store at -80 degree C for 12 months. Stability Test: The thermal stability is described by the loss rate of the targetprotein. The loss rate was determined by accelerated thermal degradation test,that is, incubate the protein at 37 degree C for 48h, and no obvious degradation andprecipitation were observed. (Referring from China Biological Products Standard,which was calculated by the Arrhenius equation.) The loss of this protein is lessthan 5% within the expiration date under appropriate storage condition.
tested application :
SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP)
other info1 :
Organism: Mus musculus (Mouse). Expression System: Prokaryotic expression. Residues: Leu123~Glu339 (Accession # O70370) with two N-terminal Tags, His-tag and S-tag. Subcellular Location Lysosome. Form & Buffer: Supplied as lyophilized form in PBS, pH7.4, containing 1mM DTT, 5% trehalose, 0.01% sarcosyl and preservative. Predicted isoelectric point: 5.6. Accurate Molecular Mass: 33kDa as determined by SDS-PAGE reducing conditions.
other info2 :
Endotoxin Level: <1.0EU per 1ug (determined by the LAL method). Reconstitution: Reconstitute in sterile PBS, pH7.2-pH7.4.
products description :
About the Marker: Effective Size Range: 10kDa to 70kDa. Protein bands: 10kDa, 14kDa, 18kDa, 22kDa, 26kDa, 33kDa, 44kDa and70kDa. Double intensity bands: The 26kDa, 18kDa, 10kDa bands are at doubleintensity to make location and size approximation of proteins of interestquick and easy. Ready-to-use: No need to heat, dilute or add reducing agents before use.
ncbi acc num :
NP_067256.4
ncbi gb acc num :
NM_021281.3
ncbi mol weight :
29.3kDa
ncbi pathways :
Adaptive Immune System Pathway (926013); Antigen Processing And Presentation Pathway (83271); Antigen Processing And Presentation Pathway (485); Antigen Processing-Cross Presentation Pathway (926037); Assembly Of Collagen Fibrils And Other Multimeric Structures Pathway (927064); Class I MHC Mediated Antigen Processing Presentation Pathway (926034); Collagen Formation Pathway (927062); Degradation Of The Extracellular Matrix Pathway (927074); Endosomal/Vacuolar Pathway (926040); Extracellular Matrix Organization Pathway (927061)
ncbi summary :
This gene encodes a member of the peptidase C1 (papain) family of cysteine proteases. Alternative splicing results in multiple transcript variants, which encode preproproteins that are proteolytically processed to generate mature protein products. This enzyme is secreted by antigen-presenting cells during inflammation and may induce pain and itch via activation of G-protein coupled receptors. Homozygous knockout mice for this gene exhibit impaired wound healing, reduced tumorigenesis in a pancreatic cancer model, and reduced pathogenesis in a myasthenia gravis model. [provided by RefSeq, Aug 2015]
uniprot summary :
CTSS: Thiol protease. Key protease responsible for the removal of the invariant chain from MHC class II molecules. The bond- specificity of this proteinase is in part similar to the specificities of cathepsin L and cathepsin N. Belongs to the peptidase C1 family. 2 isoforms of the human protein are produced by alternative splicing. Protein type: Protease; EC 3.4.22.27. Cellular Component: extracellular space; cell surface; intracellular membrane-bound organelle; membrane; lysosome. Molecular Function: collagen binding; peptidase activity; proteoglycan binding; hydrolase activity; cysteine-type endopeptidase activity; fibronectin binding; laminin binding; cysteine-type peptidase activity. Biological Process: collagen catabolic process; proteolysis involved in cellular protein catabolic process; regulation of sensory perception of pain; proteolysis; bone resorption; positive regulation of inflammatory response